Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
| Location | 1695008..1695555 | Replicon | chromosome |
| Accession | NZ_HG992751 | ||
| Organism | Vibrio sp. B1FIG11 isolate LMG10946-nano | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | KHO06_RS07970 | Protein ID | WP_212582374.1 |
| Coordinates | 1695253..1695555 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | U3A269 |
| Locus tag | KHO06_RS07965 | Protein ID | WP_005448240.1 |
| Coordinates | 1695008..1695265 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KHO06_RS07910 (ACOMICROBIO_LMKGKHOH_02195) | 1690059..1690478 | + | 420 | WP_212582369.1 | hypothetical protein | - |
| KHO06_RS07915 | 1690500..1690592 | + | 93 | WP_140288197.1 | DUF3265 domain-containing protein | - |
| KHO06_RS07920 (ACOMICROBIO_LMKGKHOH_02196) | 1691762..1692256 | - | 495 | WP_212582370.1 | hypothetical protein | - |
| KHO06_RS07925 | 1692378..1692467 | + | 90 | WP_079856435.1 | DUF3265 domain-containing protein | - |
| KHO06_RS07930 (ACOMICROBIO_LMKGKHOH_02197) | 1692495..1692911 | + | 417 | WP_212582371.1 | hypothetical protein | - |
| KHO06_RS07935 | 1692939..1693031 | + | 93 | WP_212582372.1 | DUF3265 domain-containing protein | - |
| KHO06_RS07940 (ACOMICROBIO_LOCUS1128) | 1693060..1693491 | + | 432 | WP_061058653.1 | NUDIX domain-containing protein | - |
| KHO06_RS07945 (ACOMICROBIO_LOCUS1129) | 1693682..1693939 | + | 258 | WP_005448240.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| KHO06_RS07950 (ACOMICROBIO_LMKGKHOH_02200) | 1693927..1694229 | + | 303 | WP_011080278.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| KHO06_RS07955 (ACOMICROBIO_LMKGKHOH_02201) | 1694391..1694819 | + | 429 | WP_212582373.1 | ester cyclase | - |
| KHO06_RS07960 | 1694834..1694926 | + | 93 | WP_017420623.1 | DUF3265 domain-containing protein | - |
| KHO06_RS07965 (ACOMICROBIO_LOCUS1130) | 1695008..1695265 | + | 258 | WP_005448240.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| KHO06_RS07970 (ACOMICROBIO_LMKGKHOH_02203) | 1695253..1695555 | + | 303 | WP_212582374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| KHO06_RS07975 | 1695591..1695683 | + | 93 | WP_005445734.1 | DUF3265 domain-containing protein | - |
| KHO06_RS07980 (ACOMICROBIO_LOCUS1131) | 1695718..1696506 | + | 789 | WP_212582375.1 | trypsin-like peptidase domain-containing protein | - |
| KHO06_RS07985 | 1696521..1696613 | + | 93 | WP_193784098.1 | DUF3265 domain-containing protein | - |
| KHO06_RS07990 (ACOMICROBIO_LMKGKHOH_02205) | 1696653..1697093 | + | 441 | WP_191686400.1 | hypothetical protein | - |
| KHO06_RS07995 | 1697111..1697200 | + | 90 | WP_079852034.1 | DUF3265 domain-containing protein | - |
| KHO06_RS08000 (ACOMICROBIO_LMKGKHOH_02206) | 1697236..1698081 | + | 846 | WP_212582376.1 | DUF2971 domain-containing protein | - |
| KHO06_RS08005 (ACOMICROBIO_LOCUS1132) | 1698215..1698622 | + | 408 | WP_212582377.1 | GNAT family N-acetyltransferase | - |
| KHO06_RS26470 | 1698619..1698684 | + | 66 | Protein_1557 | DUF3265 domain-containing protein | - |
| KHO06_RS26475 | 1699438..1699740 | - | 303 | WP_244858389.1 | hypothetical protein | - |
| KHO06_RS08020 | 1699869..1699958 | + | 90 | WP_241670089.1 | DUF3265 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1634562..1733951 | 99389 | |
| - | inside | Integron | - | - | 1632809..1727869 | 95060 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11682.57 Da Isoelectric Point: 4.8951
>T285279 WP_212582374.1 NZ_HG992751:1695253-1695555 [Vibrio sp. B1FIG11]
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLEAFPESGRIPPELEHLSYREVIVNPCRVFYKQDGDKV
FILFVMRAERDLRKFLLSRQ
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLEAFPESGRIPPELEHLSYREVIVNPCRVFYKQDGDKV
FILFVMRAERDLRKFLLSRQ
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|