285278

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/Phd(antitoxin)
Location 1693682..1694229 Replicon chromosome
Accession NZ_HG992751
Organism Vibrio sp. B1FIG11 isolate LMG10946-nano

Toxin (Protein)


Gene name relE Uniprot ID I3NI64
Locus tag KHO06_RS07950 Protein ID WP_011080278.1
Coordinates 1693927..1694229 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID U3A269
Locus tag KHO06_RS07945 Protein ID WP_005448240.1
Coordinates 1693682..1693939 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KHO06_RS07895 1688963..1689052 + 90 WP_072609598.1 DUF3265 domain-containing protein -
KHO06_RS07900 (ACOMICROBIO_LOCUS1127) 1689080..1689892 + 813 WP_244858388.1 nucleotide-binding protein -
KHO06_RS07905 1689920..1690012 + 93 WP_130361595.1 DUF3265 domain-containing protein -
KHO06_RS07910 (ACOMICROBIO_LMKGKHOH_02195) 1690059..1690478 + 420 WP_212582369.1 hypothetical protein -
KHO06_RS07915 1690500..1690592 + 93 WP_140288197.1 DUF3265 domain-containing protein -
KHO06_RS07920 (ACOMICROBIO_LMKGKHOH_02196) 1691762..1692256 - 495 WP_212582370.1 hypothetical protein -
KHO06_RS07925 1692378..1692467 + 90 WP_079856435.1 DUF3265 domain-containing protein -
KHO06_RS07930 (ACOMICROBIO_LMKGKHOH_02197) 1692495..1692911 + 417 WP_212582371.1 hypothetical protein -
KHO06_RS07935 1692939..1693031 + 93 WP_212582372.1 DUF3265 domain-containing protein -
KHO06_RS07940 (ACOMICROBIO_LOCUS1128) 1693060..1693491 + 432 WP_061058653.1 NUDIX domain-containing protein -
KHO06_RS07945 (ACOMICROBIO_LOCUS1129) 1693682..1693939 + 258 WP_005448240.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
KHO06_RS07950 (ACOMICROBIO_LMKGKHOH_02200) 1693927..1694229 + 303 WP_011080278.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
KHO06_RS07955 (ACOMICROBIO_LMKGKHOH_02201) 1694391..1694819 + 429 WP_212582373.1 ester cyclase -
KHO06_RS07960 1694834..1694926 + 93 WP_017420623.1 DUF3265 domain-containing protein -
KHO06_RS07965 (ACOMICROBIO_LOCUS1130) 1695008..1695265 + 258 WP_005448240.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
KHO06_RS07970 (ACOMICROBIO_LMKGKHOH_02203) 1695253..1695555 + 303 WP_212582374.1 type II toxin-antitoxin system RelE/ParE family toxin -
KHO06_RS07975 1695591..1695683 + 93 WP_005445734.1 DUF3265 domain-containing protein -
KHO06_RS07980 (ACOMICROBIO_LOCUS1131) 1695718..1696506 + 789 WP_212582375.1 trypsin-like peptidase domain-containing protein -
KHO06_RS07985 1696521..1696613 + 93 WP_193784098.1 DUF3265 domain-containing protein -
KHO06_RS07990 (ACOMICROBIO_LMKGKHOH_02205) 1696653..1697093 + 441 WP_191686400.1 hypothetical protein -
KHO06_RS07995 1697111..1697200 + 90 WP_079852034.1 DUF3265 domain-containing protein -
KHO06_RS08000 (ACOMICROBIO_LMKGKHOH_02206) 1697236..1698081 + 846 WP_212582376.1 DUF2971 domain-containing protein -
KHO06_RS08005 (ACOMICROBIO_LOCUS1132) 1698215..1698622 + 408 WP_212582377.1 GNAT family N-acetyltransferase -
KHO06_RS26470 1698619..1698684 + 66 Protein_1557 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1634562..1733951 99389
- inside Integron - - 1632809..1727869 95060


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-69)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11624.53 Da        Isoelectric Point: 4.8951

>T285278 WP_011080278.1 NZ_HG992751:1693927-1694229 [Vibrio sp. B1FIG11]
MAEIIWTEPALSDLNDIAEYIALENIVAAKQLVQAIFSKVERLEAFPESGRIPPELEHLSYREVVVNPCRIFYKQDGDKV
FILFVMRAERDLRKFLLSKQ

Download         Length: 303 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9606.10 Da        Isoelectric Point: 6.7269

>AT285278 WP_005448240.1 NZ_HG992751:1693682-1693939 [Vibrio sp. B1FIG11]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLVDVDDYEFMQNRLAILEGIARGERALADGKVVSHDEAKDKM
SKWLK

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3Q0L5T4

Antitoxin

Source ID Structure
AlphaFold DB A0A432DGX8

References