Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 525463..526049 | Replicon | chromosome |
Accession | NZ_HG992743 | ||
Organism | Vibrio sp. B1ASS3 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | KJB05_RS20885 | Protein ID | WP_208446377.1 |
Coordinates | 525720..526049 (+) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | KJB05_RS20880 | Protein ID | WP_208446378.1 |
Coordinates | 525463..525720 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJB05_RS20850 (ACOMICROBIO_LOCUS4107) | 520609..521262 | - | 654 | WP_208446451.1 | DsbA family oxidoreductase | - |
KJB05_RS20855 (ACOMICROBIO_LOCUS4108) | 521457..522620 | + | 1164 | WP_208446452.1 | MerR family transcriptional regulator | - |
KJB05_RS20860 (ACOMICROBIO_NCLOACGD_04244) | 522628..523078 | + | 451 | Protein_497 | GNAT family N-acetyltransferase | - |
KJB05_RS28780 | 523357..523982 | - | 626 | Protein_498 | IS110 family transposase | - |
KJB05_RS20875 (ACOMICROBIO_NCLOACGD_04247) | 523986..524552 | + | 567 | Protein_499 | hypothetical protein | - |
KJB05_RS20880 (ACOMICROBIO_LOCUS4111) | 525463..525720 | + | 258 | WP_208446378.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
KJB05_RS20885 (ACOMICROBIO_LOCUS4112) | 525720..526049 | + | 330 | WP_208446377.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
KJB05_RS20890 (ACOMICROBIO_LOCUS4113) | 526117..526806 | + | 690 | WP_208446376.1 | ParA family protein | - |
KJB05_RS28785 (ACOMICROBIO_NCLOACGD_04251) | 526816..527424 | + | 609 | WP_244142984.1 | hypothetical protein | - |
KJB05_RS20900 | 527835..528101 | + | 267 | Protein_504 | IS91 family transposase | - |
KJB05_RS20910 (ACOMICROBIO_LOCUS4114) | 528458..529210 | - | 753 | WP_208446375.1 | hypothetical protein | - |
KJB05_RS20915 (ACOMICROBIO_LOCUS4115) | 529511..530719 | - | 1209 | WP_208446374.1 | IS256 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 523357..523641 | 284 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12214.32 Da Isoelectric Point: 10.2893
>T285275 WP_208446377.1 NZ_HG992743:525720-526049 [Vibrio sp. B1ASS3]
MYIPDKGDIVTLDFDSSAGKEIMKRRPAFVISRKMFNEHTGFAVVAPITSTIRGMKLEVVLPESLSTQGAVLIHQVKSLD
FSNRQIRFVEKAPKHITEKVSELTKVIIS
MYIPDKGDIVTLDFDSSAGKEIMKRRPAFVISRKMFNEHTGFAVVAPITSTIRGMKLEVVLPESLSTQGAVLIHQVKSLD
FSNRQIRFVEKAPKHITEKVSELTKVIIS
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|