285272

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/Phd(antitoxin)
Location 1705455..1706002 Replicon chromosome
Accession NZ_HG992742
Organism Vibrio sp. B1ASS3

Toxin (Protein)


Gene name relE Uniprot ID A0A2K7SRN5
Locus tag KJB05_RS07970 Protein ID WP_010448451.1
Coordinates 1705700..1706002 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID U3A269
Locus tag KJB05_RS07965 Protein ID WP_005448240.1
Coordinates 1705455..1705712 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KJB05_RS07940 (ACOMICROBIO_NCLOACGD_01592) 1701024..1702379 + 1356 WP_208446506.1 Fic family protein -
KJB05_RS07945 (ACOMICROBIO_NCLOACGD_01593) 1702518..1702763 + 246 Protein_1502 GNAT family N-acetyltransferase -
KJB05_RS07950 1702816..1703124 - 309 Protein_1503 IS5/IS1182 family transposase -
KJB05_RS07955 (ACOMICROBIO_NCLOACGD_01595) 1703154..1704560 - 1407 WP_208446529.1 IS66 family transposase -
KJB05_RS07960 (ACOMICROBIO_LOCUS1059) 1704664..1705287 - 624 Protein_1505 IS5 family transposase -
KJB05_RS07965 (ACOMICROBIO_LOCUS1060) 1705455..1705712 + 258 WP_005448240.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
KJB05_RS07970 (ACOMICROBIO_NCLOACGD_01598) 1705700..1706002 + 303 WP_010448451.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
KJB05_RS07975 1706038..1706130 + 93 WP_005445235.1 DUF3265 domain-containing protein -
KJB05_RS07980 (ACOMICROBIO_NCLOACGD_01599) 1706263..1706505 + 243 WP_244142992.1 zinc ribbon domain-containing protein -
KJB05_RS28585 1706507..1706590 + 84 WP_244142991.1 DUF3265 domain-containing protein -
KJB05_RS07985 (ACOMICROBIO_NCLOACGD_01600) 1706687..1707154 + 468 WP_208446495.1 Sbal_3080 family lipoprotein -
KJB05_RS07990 1707687..1707815 + 129 WP_099098883.1 DUF3265 domain-containing protein -
KJB05_RS07995 (ACOMICROBIO_LOCUS1061) 1707848..1708393 + 546 WP_208446494.1 DUF1643 domain-containing protein -
KJB05_RS08000 (ACOMICROBIO_NCLOACGD_01602) 1708508..1708990 + 483 WP_208446493.1 hypothetical protein -
KJB05_RS28590 1710615..1710725 - 111 Protein_1516 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island fos - 1630141..1726866 96725
- inside IScluster/Tn - - 1696123..1713999 17876
- inside Integron fos - 1628844..1708990 80146


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-69)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11625.52 Da        Isoelectric Point: 5.1765

>T285272 WP_010448451.1 NZ_HG992742:1705700-1706002 [Vibrio sp. B1ASS3]
MAEVIWTEPALSDLNDIAEYIALENIVAAKQLVQTIFSKVERLQTFPESGRIPPELEHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERDLRKFLLGKQ

Download         Length: 303 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9606.10 Da        Isoelectric Point: 6.7269

>AT285272 WP_005448240.1 NZ_HG992742:1705455-1705712 [Vibrio sp. B1ASS3]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLVDVDDYEFMQNRLAILEGIARGERALADGKVVSHDEAKDKM
SKWLK

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2K7SRN5

Antitoxin

Source ID Structure
AlphaFold DB A0A432DGX8

References