Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-YefM |
| Location | 1674551..1675100 | Replicon | chromosome |
| Accession | NZ_HG992742 | ||
| Organism | Vibrio sp. B1ASS3 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | KJB05_RS07730 | Protein ID | WP_208446539.1 |
| Coordinates | 1674551..1674850 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A812FW55 |
| Locus tag | KJB05_RS07735 | Protein ID | WP_005443875.1 |
| Coordinates | 1674858..1675100 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJB05_RS07680 (ACOMICROBIO_NCLOACGD_01552) | 1669582..1670184 | + | 603 | WP_005378539.1 | hypothetical protein | - |
| KJB05_RS07685 | 1670199..1670291 | + | 93 | WP_078235911.1 | DUF3265 domain-containing protein | - |
| KJB05_RS07690 (ACOMICROBIO_NCLOACGD_01553) | 1670331..1671113 | + | 783 | WP_053319094.1 | hypothetical protein | - |
| KJB05_RS07695 (ACOMICROBIO_LOCUS1044) | 1671294..1671764 | + | 471 | WP_038888886.1 | GNAT family N-acetyltransferase | - |
| KJB05_RS07700 | 1671794..1671886 | + | 93 | WP_005536189.1 | DUF3265 domain-containing protein | - |
| KJB05_RS07705 (ACOMICROBIO_NCLOACGD_01555) | 1671913..1672320 | + | 408 | WP_208446475.1 | hypothetical protein | - |
| KJB05_RS07710 | 1672349..1672438 | + | 90 | WP_079878804.1 | DUF3265 domain-containing protein | - |
| KJB05_RS07715 (ACOMICROBIO_NCLOACGD_01556) | 1672465..1672941 | + | 477 | WP_176247059.1 | hypothetical protein | - |
| KJB05_RS07720 (ACOMICROBIO_NCLOACGD_01557) | 1673085..1673762 | + | 678 | WP_208446474.1 | hypothetical protein | - |
| KJB05_RS07725 | 1674398..1674487 | + | 90 | WP_074534701.1 | DUF3265 domain-containing protein | - |
| KJB05_RS07730 (ACOMICROBIO_NCLOACGD_01558) | 1674551..1674850 | - | 300 | WP_208446539.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| KJB05_RS07735 (ACOMICROBIO_LOCUS1045) | 1674858..1675100 | - | 243 | WP_005443875.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| KJB05_RS07740 | 1675214..1675303 | + | 90 | WP_072612536.1 | DUF3265 domain-containing protein | - |
| KJB05_RS07745 (ACOMICROBIO_NCLOACGD_01560) | 1675330..1675776 | + | 447 | WP_025543099.1 | hypothetical protein | - |
| KJB05_RS07750 | 1675801..1675893 | + | 93 | WP_079880068.1 | DUF3265 domain-containing protein | - |
| KJB05_RS07755 (ACOMICROBIO_NCLOACGD_01561) | 1675928..1676650 | + | 723 | WP_208446537.1 | hypothetical protein | - |
| KJB05_RS07760 | 1677294..1677383 | + | 90 | WP_074534701.1 | DUF3265 domain-containing protein | - |
| KJB05_RS07765 (ACOMICROBIO_NCLOACGD_01562) | 1677411..1677680 | + | 270 | WP_208446538.1 | hypothetical protein | - |
| KJB05_RS07770 (ACOMICROBIO_NCLOACGD_01563) | 1677835..1678287 | + | 453 | WP_244142998.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | fos | - | 1630141..1726866 | 96725 | |
| - | inside | Integron | fos | - | 1628844..1708990 | 80146 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11552.17 Da Isoelectric Point: 9.6424
>T285271 WP_208446539.1 NZ_HG992742:c1674850-1674551 [Vibrio sp. B1ASS3]
MQKNRYKLSNLAQSHLRKVKNYTVENFSELQWRNYKDTLLSGFQMLADNPGLGRSCHELYPNGFYFPIGKHTAYFTKEDD
FILVVAVLGQSQLPQNHLK
MQKNRYKLSNLAQSHLRKVKNYTVENFSELQWRNYKDTLLSGFQMLADNPGLGRSCHELYPNGFYFPIGKHTAYFTKEDD
FILVVAVLGQSQLPQNHLK
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|