285271

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-YefM
Location 1674551..1675100 Replicon chromosome
Accession NZ_HG992742
Organism Vibrio sp. B1ASS3

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag KJB05_RS07730 Protein ID WP_208446539.1
Coordinates 1674551..1674850 (-) Length 100 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A812FW55
Locus tag KJB05_RS07735 Protein ID WP_005443875.1
Coordinates 1674858..1675100 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KJB05_RS07680 (ACOMICROBIO_NCLOACGD_01552) 1669582..1670184 + 603 WP_005378539.1 hypothetical protein -
KJB05_RS07685 1670199..1670291 + 93 WP_078235911.1 DUF3265 domain-containing protein -
KJB05_RS07690 (ACOMICROBIO_NCLOACGD_01553) 1670331..1671113 + 783 WP_053319094.1 hypothetical protein -
KJB05_RS07695 (ACOMICROBIO_LOCUS1044) 1671294..1671764 + 471 WP_038888886.1 GNAT family N-acetyltransferase -
KJB05_RS07700 1671794..1671886 + 93 WP_005536189.1 DUF3265 domain-containing protein -
KJB05_RS07705 (ACOMICROBIO_NCLOACGD_01555) 1671913..1672320 + 408 WP_208446475.1 hypothetical protein -
KJB05_RS07710 1672349..1672438 + 90 WP_079878804.1 DUF3265 domain-containing protein -
KJB05_RS07715 (ACOMICROBIO_NCLOACGD_01556) 1672465..1672941 + 477 WP_176247059.1 hypothetical protein -
KJB05_RS07720 (ACOMICROBIO_NCLOACGD_01557) 1673085..1673762 + 678 WP_208446474.1 hypothetical protein -
KJB05_RS07725 1674398..1674487 + 90 WP_074534701.1 DUF3265 domain-containing protein -
KJB05_RS07730 (ACOMICROBIO_NCLOACGD_01558) 1674551..1674850 - 300 WP_208446539.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
KJB05_RS07735 (ACOMICROBIO_LOCUS1045) 1674858..1675100 - 243 WP_005443875.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
KJB05_RS07740 1675214..1675303 + 90 WP_072612536.1 DUF3265 domain-containing protein -
KJB05_RS07745 (ACOMICROBIO_NCLOACGD_01560) 1675330..1675776 + 447 WP_025543099.1 hypothetical protein -
KJB05_RS07750 1675801..1675893 + 93 WP_079880068.1 DUF3265 domain-containing protein -
KJB05_RS07755 (ACOMICROBIO_NCLOACGD_01561) 1675928..1676650 + 723 WP_208446537.1 hypothetical protein -
KJB05_RS07760 1677294..1677383 + 90 WP_074534701.1 DUF3265 domain-containing protein -
KJB05_RS07765 (ACOMICROBIO_NCLOACGD_01562) 1677411..1677680 + 270 WP_208446538.1 hypothetical protein -
KJB05_RS07770 (ACOMICROBIO_NCLOACGD_01563) 1677835..1678287 + 453 WP_244142998.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island fos - 1630141..1726866 96725
- inside Integron fos - 1628844..1708990 80146


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-93)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-55)


Sequences

Toxin        


Download         Length: 100 a.a.        Molecular weight: 11552.17 Da        Isoelectric Point: 9.6424

>T285271 WP_208446539.1 NZ_HG992742:c1674850-1674551 [Vibrio sp. B1ASS3]
MQKNRYKLSNLAQSHLRKVKNYTVENFSELQWRNYKDTLLSGFQMLADNPGLGRSCHELYPNGFYFPIGKHTAYFTKEDD
FILVVAVLGQSQLPQNHLK

Download         Length: 300 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9047.26 Da        Isoelectric Point: 5.6926

>AT285271 WP_005443875.1 NZ_HG992742:c1675100-1674858 [Vibrio sp. B1ASS3]
MHTLTANDAKRNFGELLLSAQREPVKISKNSKDTVVVMSIRDFEELEAMKVEYLKHCFKSAKEDLNNGNTVDGESFINSL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A812FW55

References