Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /GNAT-DUF1778
Location 1655798..1656564 Replicon chromosome
Accession NZ_HG992742
Organism Vibrio sp. B1ASS3

Toxin (Protein)


Gene name - Uniprot ID A0A2K7SQA7
Locus tag KJB05_RS07580 Protein ID WP_017420533.1
Coordinates 1655798..1656295 (-) Length 166 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A347UQX1
Locus tag KJB05_RS07585 Protein ID WP_017420534.1
Coordinates 1656292..1656564 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KJB05_RS07520 1651522..1651836 + 315 WP_213053108.1 hypothetical protein -
KJB05_RS07525 (ACOMICROBIO_LOCUS1036) 1652081..1652380 + 300 WP_072036459.1 WYL domain-containing protein -
KJB05_RS07530 1652395..1652487 + 93 WP_079720568.1 DUF3265 domain-containing protein -
KJB05_RS07535 (ACOMICROBIO_NCLOACGD_01531) 1652514..1652960 + 447 WP_025543099.1 hypothetical protein -
KJB05_RS07540 1652985..1653077 + 93 WP_079880068.1 DUF3265 domain-containing protein -
KJB05_RS07545 (ACOMICROBIO_NCLOACGD_01532) 1653105..1653464 + 360 WP_208446552.1 hypothetical protein -
KJB05_RS07550 1653461..1653571 + 111 WP_017822022.1 DUF3265 domain-containing protein -
KJB05_RS07555 (ACOMICROBIO_NCLOACGD_01533) 1653599..1653991 + 393 WP_208446482.1 hypothetical protein -
KJB05_RS07560 1654013..1654105 + 93 WP_005534950.1 DUF3265 domain-containing protein -
KJB05_RS07565 (ACOMICROBIO_LOCUS1037) 1654134..1654532 + 399 WP_208446481.1 FosG/FosC2-related fosfomycin resistance glutathione transferase -
KJB05_RS07570 (ACOMICROBIO_NCLOACGD_01535) 1654692..1655657 + 966 WP_208446480.1 type I restriction enzyme HsdR N-terminal domain-containing protein -
KJB05_RS07575 1655672..1655764 + 93 WP_079380089.1 DUF3265 domain-containing protein -
KJB05_RS07580 (ACOMICROBIO_LOCUS1038) 1655798..1656295 - 498 WP_017420533.1 GNAT family N-acetyltransferase Toxin
KJB05_RS07585 (ACOMICROBIO_NCLOACGD_01537) 1656292..1656564 - 273 WP_017420534.1 DUF1778 domain-containing protein Antitoxin
KJB05_RS07590 1656674..1656766 + 93 WP_208446479.1 DUF3265 domain-containing protein -
KJB05_RS07595 (ACOMICROBIO_NCLOACGD_01538) 1656857..1657291 + 435 WP_208446478.1 hypothetical protein -
KJB05_RS07600 (ACOMICROBIO_NCLOACGD_01539) 1657292..1657987 + 696 WP_208446477.1 hypothetical protein -
KJB05_RS07605 (ACOMICROBIO_NCLOACGD_01540) 1658139..1658813 + 675 WP_208446544.1 hypothetical protein -
KJB05_RS07610 1658855..1658944 + 90 WP_080259987.1 DUF3265 domain-containing protein -
KJB05_RS07615 (ACOMICROBIO_LOCUS1039) 1658970..1659746 + 777 WP_208446437.1 choline kinase -
KJB05_RS07620 (ACOMICROBIO_NCLOACGD_01542) 1659907..1660602 + 696 WP_208446436.1 NgoFVII family restriction endonuclease -
KJB05_RS07625 1660650..1660742 + 93 WP_072600976.1 DUF3265 domain-containing protein -
KJB05_RS28560 1661161..1661290 + 130 Protein_1435 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island fos - 1630141..1726866 96725
- inside Integron fos - 1628844..1708990 80146


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(86-151)

Antitoxin

Vibrio phage ICP1, Orf50

(7-86)


Sequences

Toxin        


Download         Length: 166 a.a.        Molecular weight: 18467.13 Da        Isoelectric Point: 8.8117

>T285270 WP_017420533.1 NZ_HG992742:c1656295-1655798 [Vibrio sp. B1ASS3]
MMNTVLLDKAKHDRNRFNCGIEALNNYLKVMASQQAKKDNTRTFVLEDDSDNSHVIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFHDAENKLFITIADV
RASLG

Download         Length: 498 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 9735.22 Da        Isoelectric Point: 8.5960

>AT285270 WP_017420534.1 NZ_HG992742:c1656564-1656292 [Vibrio sp. B1ASS3]
MATTLPRITARVDVDTQDLLTKAAAIAGMSSINSFVLSAAIEKAKQVIEREQALKLSQADAMLLMEALDRPATQNSKLKA
AADRYESKTQ

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2K7SQA7

Antitoxin

Source ID Structure
AlphaFold DB A0A347UQX1

References