Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
Location | 74120..74664 | Replicon | chromosome |
Accession | NZ_HG992342 | ||
Organism | Xanthomonas arboricola pv. corylina strain CFBP 6600 isolate K100-1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | P3C55_RS00270 | Protein ID | WP_228960823.1 |
Coordinates | 74395..74664 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2N7V9L6 |
Locus tag | P3C55_RS00265 | Protein ID | WP_016902922.1 |
Coordinates | 74120..74377 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P3C55_RS00250 (CFBP6600_00500) | 69228..70736 | - | 1509 | WP_016904858.1 | ribonuclease H-like domain-containing protein | - |
P3C55_RS00255 (CFBP6600_00510) | 70733..73228 | - | 2496 | WP_016904859.1 | DEAD/DEAH box helicase | - |
P3C55_RS00260 (CFBP6600_00520) | 73402..74064 | + | 663 | WP_039511099.1 | hemolysin III family protein | - |
P3C55_RS00265 (CFBP6600_00530) | 74120..74377 | + | 258 | WP_016902922.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
P3C55_RS00270 (CFBP6600_00540) | 74395..74664 | + | 270 | WP_228960823.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P3C55_RS00275 (CFBP6600_00550) | 74783..75304 | - | 522 | WP_016902924.1 | hypothetical protein | - |
P3C55_RS00280 (CFBP6600_00560) | 75474..75827 | - | 354 | WP_016902925.1 | helix-turn-helix domain-containing protein | - |
P3C55_RS00285 (CFBP6600_00570) | 75850..76068 | + | 219 | WP_230673957.1 | YciI family protein | - |
P3C55_RS00290 (CFBP6600_00580) | 76228..77319 | - | 1092 | WP_039815611.1 | ATP-grasp fold amidoligase family protein | - |
P3C55_RS00295 (CFBP6600_00590) | 77776..78489 | + | 714 | WP_039815609.1 | hypothetical protein | - |
P3C55_RS00300 (CFBP6600_00600) | 78500..79393 | - | 894 | WP_104613304.1 | LysR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10221.75 Da Isoelectric Point: 10.1539
>T285266 WP_228960823.1 NZ_HG992342:74395-74664 [Xanthomonas arboricola pv. corylina]
VADLDAIADYIALEDAAAAAALVRRVFAHVEQLAEHPESGSRPQELKRSRYRQIVEPPCRVFYRVDGQRVVVVHVMRSER
LLRKNRLSR
VADLDAIADYIALEDAAAAAALVRRVFAHVEQLAEHPESGSRPQELKRSRYRQIVEPPCRVFYRVDGQRVVVVHVMRSER
LLRKNRLSR
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|