Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
| Location | 74016..74560 | Replicon | chromosome |
| Accession | NZ_HG992338 | ||
| Organism | Xanthomonas arboricola pv. corylina strain 301 isolate 301 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | P3C56_RS00270 | Protein ID | WP_228960823.1 |
| Coordinates | 74291..74560 (+) | Length | 90 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A2N7V9L6 |
| Locus tag | P3C56_RS00265 | Protein ID | WP_016902922.1 |
| Coordinates | 74016..74273 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3C56_RS00250 (XAC301_00490) | 69124..70632 | - | 1509 | WP_275548237.1 | ribonuclease H-like domain-containing protein | - |
| P3C56_RS00255 (XAC301_00500) | 70629..73124 | - | 2496 | WP_016904859.1 | DEAD/DEAH box helicase | - |
| P3C56_RS00260 (XAC301_00510) | 73298..73960 | + | 663 | WP_039511099.1 | hemolysin III family protein | - |
| P3C56_RS00265 (XAC301_00520) | 74016..74273 | + | 258 | WP_016902922.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| P3C56_RS00270 (XAC301_00530) | 74291..74560 | + | 270 | WP_228960823.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P3C56_RS00275 (XAC301_00540) | 74679..75200 | - | 522 | WP_016902924.1 | hypothetical protein | - |
| P3C56_RS00280 (XAC301_00550) | 75370..75723 | - | 354 | WP_016902925.1 | helix-turn-helix domain-containing protein | - |
| P3C56_RS00285 (XAC301_00560) | 75746..75964 | + | 219 | WP_230673957.1 | YciI family protein | - |
| P3C56_RS00290 (XAC301_00570) | 76124..77215 | - | 1092 | WP_275548498.1 | ATP-grasp fold amidoligase family protein | - |
| P3C56_RS00295 (XAC301_00580) | 77672..78385 | + | 714 | WP_053046149.1 | hypothetical protein | - |
| P3C56_RS00300 (XAC301_00590) | 78396..79289 | - | 894 | WP_275548238.1 | LysR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10221.75 Da Isoelectric Point: 10.1539
>T285260 WP_228960823.1 NZ_HG992338:74291-74560 [Xanthomonas arboricola pv. corylina]
VADLDAIADYIALEDAAAAAALVRRVFAHVEQLAEHPESGSRPQELKRSRYRQIVEPPCRVFYRVDGQRVVVVHVMRSER
LLRKNRLSR
VADLDAIADYIALEDAAAAAALVRRVFAHVEQLAEHPESGSRPQELKRSRYRQIVEPPCRVFYRVDGQRVVVVHVMRSER
LLRKNRLSR
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|