Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-DUF971 |
| Location | 2250886..2251459 | Replicon | chromosome |
| Accession | NZ_HG969192 | ||
| Organism | Bartonella tribocorum strain BM1374166 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | A0A5B9CX33 |
| Locus tag | BM1374166_RS09920 | Protein ID | WP_012232364.1 |
| Coordinates | 2250886..2251194 (+) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | A0A5B9CYS4 |
| Locus tag | BM1374166_RS09925 | Protein ID | WP_012232365.1 |
| Coordinates | 2251175..2251459 (+) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BM1374166_RS11925 | 2246046..2247341 | - | 1296 | WP_012232359.1 | hypothetical protein | - |
| BM1374166_RS09900 | 2247376..2248227 | - | 852 | WP_012232360.1 | hypothetical protein | - |
| BM1374166_RS09905 | 2248229..2248654 | - | 426 | WP_012232361.1 | hypothetical protein | - |
| BM1374166_RS09910 | 2248654..2250111 | - | 1458 | WP_012232362.1 | hypothetical protein | - |
| BM1374166_RS09915 | 2250113..2250820 | - | 708 | WP_012232363.1 | hypothetical protein | - |
| BM1374166_RS09920 | 2250886..2251194 | + | 309 | WP_012232364.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| BM1374166_RS09925 | 2251175..2251459 | + | 285 | WP_012232365.1 | putative addiction module antidote protein | Antitoxin |
| BM1374166_RS09930 | 2251495..2251875 | - | 381 | WP_012232366.1 | hypothetical protein | - |
| BM1374166_RS09935 | 2251886..2252266 | - | 381 | WP_012232367.1 | hypothetical protein | - |
| BM1374166_RS09940 | 2252289..2253416 | - | 1128 | WP_012232368.1 | N4-gp56 family major capsid protein | - |
| BM1374166_RS09945 | 2253510..2254397 | - | 888 | WP_012232369.1 | hypothetical protein | - |
| BM1374166_RS09950 | 2254411..2256429 | - | 2019 | WP_012232370.1 | phage portal protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2227959..2281718 | 53759 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11876.83 Da Isoelectric Point: 9.9055
>T285256 WP_012232364.1 NZ_HG969192:2250886-2251194 [Bartonella tribocorum]
MIFIHKTIEFDNWLKKLKDKKAKAIILQRVVRLKQGLLGDVKFFNSIGEVRIHYGAGYRIYFTQKGSDFILLLCGGDKST
QQRDIEQALKLKEEYSDENNPI
MIFIHKTIEFDNWLKKLKDKKAKAIILQRVVRLKQGLLGDVKFFNSIGEVRIHYGAGYRIYFTQKGSDFILLLCGGDKST
QQRDIEQALKLKEEYSDENNPI
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5B9CX33 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5B9CYS4 |