Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | paaR-paaA-parE/RelE(toxin) |
| Location | 2113762..2114240 | Replicon | chromosome |
| Accession | NZ_HG969192 | ||
| Organism | Bartonella tribocorum strain BM1374166 | ||
Toxin (Protein)
| Gene name | parE_1 | Uniprot ID | - |
| Locus tag | BM1374166_RS09195 | Protein ID | WP_038473997.1 |
| Coordinates | 2113953..2114240 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | paaA | Uniprot ID | - |
| Locus tag | BM1374166_RS09190 | Protein ID | WP_038473994.1 |
| Coordinates | 2113762..2113953 (+) | Length | 64 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BM1374166_RS12925 | 2110380..2110550 | - | 171 | WP_158305295.1 | hypothetical protein | - |
| BM1374166_RS12930 | 2110817..2110981 | - | 165 | WP_158305296.1 | hypothetical protein | - |
| BM1374166_RS12935 | 2111064..2111222 | - | 159 | WP_158305297.1 | hypothetical protein | - |
| BM1374166_RS09180 | 2112007..2112222 | - | 216 | WP_038473992.1 | hypothetical protein | - |
| BM1374166_RS09185 | 2113024..2113431 | + | 408 | WP_012232283.1 | helix-turn-helix domain-containing protein | - |
| BM1374166_RS09190 | 2113762..2113953 | + | 192 | WP_038473994.1 | hypothetical protein | Antitoxin |
| BM1374166_RS09195 | 2113953..2114240 | + | 288 | WP_038473997.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| BM1374166_RS09200 | 2114730..2115122 | - | 393 | WP_038474003.1 | hypothetical protein | - |
| BM1374166_RS09215 | 2116458..2116879 | + | 422 | Protein_1731 | helix-turn-helix transcriptional regulator | - |
| BM1374166_RS09220 | 2116961..2117359 | - | 399 | WP_012232286.1 | type II toxin-antitoxin system VapC family toxin | - |
| BM1374166_RS09225 | 2117356..2117607 | - | 252 | WP_005774741.1 | DNA-binding protein | - |
| BM1374166_RS09230 | 2118380..2118769 | + | 390 | WP_012232287.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11073.07 Da Isoelectric Point: 9.9304
>T285255 WP_038473997.1 NZ_HG969192:2113953-2114240 [Bartonella tribocorum]
MLPIIWLACARDDLNKILTYIAYESPPAARRMKRLLEDSVLPLAEHPYLYRQSEKVPGLREVLAHPNYLILYRVTKTQIE
ITSVVHARRKFPIST
MLPIIWLACARDDLNKILTYIAYESPPAARRMKRLLEDSVLPLAEHPYLYRQSEKVPGLREVLAHPNYLILYRVTKTQIE
ITSVVHARRKFPIST
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|