Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-DUF971 |
| Location | 1159844..1160417 | Replicon | chromosome |
| Accession | NZ_HG969192 | ||
| Organism | Bartonella tribocorum strain BM1374166 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | A0A5B9CX33 |
| Locus tag | BM1374166_RS05075 | Protein ID | WP_012232364.1 |
| Coordinates | 1160109..1160417 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | A0A5B9CYS4 |
| Locus tag | BM1374166_RS05070 | Protein ID | WP_012232365.1 |
| Coordinates | 1159844..1160128 (-) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BM1374166_RS05035 | 1155071..1156558 | - | 1488 | WP_038473542.1 | DUF3987 domain-containing protein | - |
| BM1374166_RS12835 | 1156530..1156679 | - | 150 | WP_169309787.1 | hypothetical protein | - |
| BM1374166_RS12530 | 1156816..1156887 | - | 72 | Protein_962 | virulence-associated protein E | - |
| BM1374166_RS05045 | 1156986..1157186 | - | 201 | WP_007347430.1 | DNA-binding protein | - |
| BM1374166_RS05050 | 1157395..1158561 | - | 1167 | WP_012231670.1 | site-specific integrase | - |
| BM1374166_RS05055 | 1158724..1159014 | + | 291 | Protein_965 | DUF4043 family protein | - |
| BM1374166_RS05060 | 1159037..1159417 | + | 381 | WP_012232367.1 | hypothetical protein | - |
| BM1374166_RS05065 | 1159428..1159808 | + | 381 | WP_012232366.1 | hypothetical protein | - |
| BM1374166_RS05070 | 1159844..1160128 | - | 285 | WP_012232365.1 | putative addiction module antidote protein | Antitoxin |
| BM1374166_RS05075 | 1160109..1160417 | - | 309 | WP_012232364.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| BM1374166_RS05080 | 1160483..1161190 | + | 708 | WP_012232363.1 | hypothetical protein | - |
| BM1374166_RS05085 | 1161192..1162649 | + | 1458 | WP_012231677.1 | hypothetical protein | - |
| BM1374166_RS05090 | 1162649..1163074 | + | 426 | WP_012231678.1 | hypothetical protein | - |
| BM1374166_RS05095 | 1163076..1163999 | + | 924 | WP_012231679.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1013501..1192685 | 179184 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11876.83 Da Isoelectric Point: 9.9055
>T285254 WP_012232364.1 NZ_HG969192:c1160417-1160109 [Bartonella tribocorum]
MIFIHKTIEFDNWLKKLKDKKAKAIILQRVVRLKQGLLGDVKFFNSIGEVRIHYGAGYRIYFTQKGSDFILLLCGGDKST
QQRDIEQALKLKEEYSDENNPI
MIFIHKTIEFDNWLKKLKDKKAKAIILQRVVRLKQGLLGDVKFFNSIGEVRIHYGAGYRIYFTQKGSDFILLLCGGDKST
QQRDIEQALKLKEEYSDENNPI
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5B9CX33 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5B9CYS4 |