Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelE-RHH |
Location | 1141283..1141842 | Replicon | chromosome |
Accession | NZ_HG969192 | ||
Organism | Bartonella tribocorum strain BM1374166 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A9IPY8 |
Locus tag | BM1374166_RS04975 | Protein ID | WP_012231080.1 |
Coordinates | 1141283..1141555 (-) | Length | 91 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A5B9CWB1 |
Locus tag | BM1374166_RS04980 | Protein ID | WP_012231079.1 |
Coordinates | 1141552..1141842 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BM1374166_RS04970 | 1140137..1141102 | - | 966 | WP_081821882.1 | DUF3987 domain-containing protein | - |
BM1374166_RS04975 | 1141283..1141555 | - | 273 | WP_012231080.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
BM1374166_RS04980 | 1141552..1141842 | - | 291 | WP_012231079.1 | hypothetical protein | Antitoxin |
BM1374166_RS12830 | 1142300..1142449 | - | 150 | WP_169309788.1 | hypothetical protein | - |
BM1374166_RS04985 | 1142546..1142746 | - | 201 | WP_012231078.1 | DNA-binding protein | - |
BM1374166_RS04990 | 1142947..1144111 | - | 1165 | Protein_953 | integrase arm-type DNA-binding domain-containing protein | - |
BM1374166_RS04995 | 1144322..1144945 | + | 624 | WP_012231664.1 | DNA adenine methylase | - |
BM1374166_RS05000 | 1145456..1145674 | + | 219 | WP_005773872.1 | hypothetical protein | - |
BM1374166_RS05005 | 1145679..1145951 | + | 273 | WP_012231665.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1013501..1192685 | 179184 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 91 a.a. Molecular weight: 10612.57 Da Isoelectric Point: 10.9313
>T285253 WP_012231080.1 NZ_HG969192:c1141555-1141283 [Bartonella tribocorum]
MKLIWTQVARVDRKKIREYISQNNPSAALKFDQLLSEKIEKLVKFSTLGRLGRVVNTREFIVHPNYIMIYDISDGVVRIL
RVLHTKQKFP
MKLIWTQVARVDRKKIREYISQNNPSAALKFDQLLSEKIEKLVKFSTLGRLGRVVNTREFIVHPNYIMIYDISDGVVRIL
RVLHTKQKFP
Download Length: 273 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A9IPY8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5B9CWB1 |