285252

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1022478..1023070 Replicon chromosome
Accession NZ_HG969192
Organism Bartonella tribocorum strain BM1374166

Toxin (Protein)


Gene name hicA Uniprot ID A9ISY3
Locus tag BM1374166_RS04475 Protein ID WP_012231574.1
Coordinates 1022870..1023070 (-) Length 67 a.a.

Antitoxin (Protein)


Gene name hicA Uniprot ID A9ISY1
Locus tag BM1374166_RS04470 Protein ID WP_012231571.1
Coordinates 1022478..1022873 (-) Length 132 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BM1374166_RS12135 1017919..1018217 + 299 Protein_838 BrnT family toxin -
BM1374166_RS04430 1018204..1018476 + 273 WP_012231561.1 BrnA antitoxin family protein -
BM1374166_RS04435 1018518..1018816 + 299 Protein_840 type II toxin-antitoxin system HicB family antitoxin -
BM1374166_RS04440 1018889..1019170 + 282 WP_012231565.1 type II toxin-antitoxin system RelE/ParE family toxin -
BM1374166_RS04445 1019186..1019473 + 288 WP_007346872.1 HigA family addiction module antidote protein -
BM1374166_RS04450 1019518..1019796 - 279 WP_012231568.1 hypothetical protein -
BM1374166_RS04455 1019793..1020506 - 714 WP_012231569.1 phage antirepressor Ant -
BM1374166_RS04460 1021102..1021680 - 579 WP_012231073.1 hypothetical protein -
BM1374166_RS04465 1021684..1022004 - 321 WP_012231570.1 hypothetical protein -
BM1374166_RS04470 1022478..1022873 - 396 WP_012231571.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
BM1374166_RS04475 1022870..1023070 - 201 WP_012231574.1 type II toxin-antitoxin system HicA family toxin Toxin
BM1374166_RS04480 1023135..1023671 - 537 WP_012231576.1 hypothetical protein -
BM1374166_RS04485 1023682..1024128 - 447 WP_038473476.1 single-stranded DNA-binding protein -
BM1374166_RS04490 1024369..1024560 + 192 WP_038473479.1 hypothetical protein -
BM1374166_RS04495 1024630..1025058 + 429 WP_012231580.1 type II toxin-antitoxin system HicB family antitoxin -
BM1374166_RS04500 1025107..1025655 - 549 WP_012231582.1 antA/AntB antirepressor family protein -
BM1374166_RS04505 1025869..1026246 - 378 WP_012231584.1 hypothetical protein -
BM1374166_RS04510 1026408..1026827 - 420 WP_012231586.1 hypothetical protein -
BM1374166_RS04515 1026820..1027923 - 1104 WP_012231587.1 DUF1376 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1013501..1192685 179184


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(5-125)


Sequences

Toxin        


Download         Length: 67 a.a.        Molecular weight: 7493.75 Da        Isoelectric Point: 10.7918

>T285252 WP_012231574.1 NZ_HG969192:c1023070-1022870 [Bartonella tribocorum]
MEQNSRKIIAKLKRDGFELVKVKGSHHKFEKDGKVVIVPHPKKNLPIGTARSIAQQAGWFKKGEEE

Download         Length: 201 bp

Antitoxin


Download         Length: 132 a.a.        Molecular weight: 14734.71 Da        Isoelectric Point: 4.3191

>AT285252 WP_012231571.1 NZ_HG969192:c1022873-1022478 [Bartonella tribocorum]
MKRFFALVHKDEDSAFGVQFPDFEGLFSASDEEENLIINATEALQLYCEDMDTVPVPLKFEEVIQQKAVKKALSEGAFLI
QVPFIENDSEVVRTNISIERGLLRAIDNCAQERGLTRSAFLATAARHELNI

Download         Length: 396 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A9ISY3

Antitoxin

Source ID Structure
AlphaFold DB A9ISY1

References