Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1022478..1023070 | Replicon | chromosome |
| Accession | NZ_HG969192 | ||
| Organism | Bartonella tribocorum strain BM1374166 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A9ISY3 |
| Locus tag | BM1374166_RS04475 | Protein ID | WP_012231574.1 |
| Coordinates | 1022870..1023070 (-) | Length | 67 a.a. |
Antitoxin (Protein)
| Gene name | hicA | Uniprot ID | A9ISY1 |
| Locus tag | BM1374166_RS04470 | Protein ID | WP_012231571.1 |
| Coordinates | 1022478..1022873 (-) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BM1374166_RS12135 | 1017919..1018217 | + | 299 | Protein_838 | BrnT family toxin | - |
| BM1374166_RS04430 | 1018204..1018476 | + | 273 | WP_012231561.1 | BrnA antitoxin family protein | - |
| BM1374166_RS04435 | 1018518..1018816 | + | 299 | Protein_840 | type II toxin-antitoxin system HicB family antitoxin | - |
| BM1374166_RS04440 | 1018889..1019170 | + | 282 | WP_012231565.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| BM1374166_RS04445 | 1019186..1019473 | + | 288 | WP_007346872.1 | HigA family addiction module antidote protein | - |
| BM1374166_RS04450 | 1019518..1019796 | - | 279 | WP_012231568.1 | hypothetical protein | - |
| BM1374166_RS04455 | 1019793..1020506 | - | 714 | WP_012231569.1 | phage antirepressor Ant | - |
| BM1374166_RS04460 | 1021102..1021680 | - | 579 | WP_012231073.1 | hypothetical protein | - |
| BM1374166_RS04465 | 1021684..1022004 | - | 321 | WP_012231570.1 | hypothetical protein | - |
| BM1374166_RS04470 | 1022478..1022873 | - | 396 | WP_012231571.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| BM1374166_RS04475 | 1022870..1023070 | - | 201 | WP_012231574.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| BM1374166_RS04480 | 1023135..1023671 | - | 537 | WP_012231576.1 | hypothetical protein | - |
| BM1374166_RS04485 | 1023682..1024128 | - | 447 | WP_038473476.1 | single-stranded DNA-binding protein | - |
| BM1374166_RS04490 | 1024369..1024560 | + | 192 | WP_038473479.1 | hypothetical protein | - |
| BM1374166_RS04495 | 1024630..1025058 | + | 429 | WP_012231580.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| BM1374166_RS04500 | 1025107..1025655 | - | 549 | WP_012231582.1 | antA/AntB antirepressor family protein | - |
| BM1374166_RS04505 | 1025869..1026246 | - | 378 | WP_012231584.1 | hypothetical protein | - |
| BM1374166_RS04510 | 1026408..1026827 | - | 420 | WP_012231586.1 | hypothetical protein | - |
| BM1374166_RS04515 | 1026820..1027923 | - | 1104 | WP_012231587.1 | DUF1376 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1013501..1192685 | 179184 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 67 a.a. Molecular weight: 7493.75 Da Isoelectric Point: 10.7918
>T285252 WP_012231574.1 NZ_HG969192:c1023070-1022870 [Bartonella tribocorum]
MEQNSRKIIAKLKRDGFELVKVKGSHHKFEKDGKVVIVPHPKKNLPIGTARSIAQQAGWFKKGEEE
MEQNSRKIIAKLKRDGFELVKVKGSHHKFEKDGKVVIVPHPKKNLPIGTARSIAQQAGWFKKGEEE
Download Length: 201 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14734.71 Da Isoelectric Point: 4.3191
>AT285252 WP_012231571.1 NZ_HG969192:c1022873-1022478 [Bartonella tribocorum]
MKRFFALVHKDEDSAFGVQFPDFEGLFSASDEEENLIINATEALQLYCEDMDTVPVPLKFEEVIQQKAVKKALSEGAFLI
QVPFIENDSEVVRTNISIERGLLRAIDNCAQERGLTRSAFLATAARHELNI
MKRFFALVHKDEDSAFGVQFPDFEGLFSASDEEENLIINATEALQLYCEDMDTVPVPLKFEEVIQQKAVKKALSEGAFLI
QVPFIENDSEVVRTNISIERGLLRAIDNCAQERGLTRSAFLATAARHELNI
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|