Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 490437..491017 | Replicon | chromosome |
Accession | NZ_HG969192 | ||
Organism | Bartonella tribocorum strain BM1374166 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A9IPA9 |
Locus tag | BM1374166_RS02060 | Protein ID | WP_012230991.1 |
Coordinates | 490691..491017 (+) | Length | 109 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A9IPA6 |
Locus tag | BM1374166_RS02055 | Protein ID | WP_012230990.1 |
Coordinates | 490437..490694 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BM1374166_RS02020 | 486569..486775 | + | 207 | WP_038474459.1 | hypothetical protein | - |
BM1374166_RS11830 | 487067..488465 | + | 1399 | Protein_384 | AAA family ATPase | - |
BM1374166_RS02035 | 488614..488937 | - | 324 | WP_038473287.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
BM1374166_RS02040 | 488937..489161 | - | 225 | WP_012230987.1 | antitoxin MazE family protein | - |
BM1374166_RS02045 | 489384..489830 | + | 447 | WP_012230988.1 | single-stranded DNA-binding protein | - |
BM1374166_RS02050 | 489884..490384 | + | 501 | WP_012230989.1 | hypothetical protein | - |
BM1374166_RS02055 | 490437..490694 | + | 258 | WP_012230990.1 | antitoxin | Antitoxin |
BM1374166_RS02060 | 490691..491017 | + | 327 | WP_012230991.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
BM1374166_RS02065 | 491228..491455 | + | 228 | WP_007346764.1 | ribbon-helix-helix protein, CopG family | - |
BM1374166_RS02070 | 491439..491708 | + | 270 | WP_012230995.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
BM1374166_RS02080 | 492257..492700 | - | 444 | WP_012231000.1 | hypothetical protein | - |
BM1374166_RS02090 | 494847..495371 | - | 525 | WP_081458153.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 477153..595130 | 117977 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 12019.08 Da Isoelectric Point: 10.8352
>T285248 WP_012230991.1 NZ_HG969192:490691-491017 [Bartonella tribocorum]
MRRGDIYMVDLEPIQGREQRGYRPVVIVSPDDFNQATGLPVILPITSGGNFVRRIGFAVPLTGTRTRGVIRCDQPRVLDL
VVRNGRKVESLPTVIMNEVLAKVVTIFS
MRRGDIYMVDLEPIQGREQRGYRPVVIVSPDDFNQATGLPVILPITSGGNFVRRIGFAVPLTGTRTRGVIRCDQPRVLDL
VVRNGRKVESLPTVIMNEVLAKVVTIFS
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|