Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-MazE |
| Location | 488614..489161 | Replicon | chromosome |
| Accession | NZ_HG969192 | ||
| Organism | Bartonella tribocorum strain BM1374166 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | BM1374166_RS02035 | Protein ID | WP_038473287.1 |
| Coordinates | 488614..488937 (-) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A9IP98 |
| Locus tag | BM1374166_RS02040 | Protein ID | WP_012230987.1 |
| Coordinates | 488937..489161 (-) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BM1374166_RS02000 | 483799..484401 | - | 603 | WP_012230972.1 | XRE family transcriptional regulator | - |
| BM1374166_RS02005 | 484503..484748 | + | 246 | WP_038474456.1 | helix-turn-helix domain-containing protein | - |
| BM1374166_RS02010 | 484792..485270 | + | 479 | Protein_381 | hypothetical protein | - |
| BM1374166_RS02015 | 485260..486405 | + | 1146 | WP_012230977.1 | DUF1376 domain-containing protein | - |
| BM1374166_RS02020 | 486569..486775 | + | 207 | WP_038474459.1 | hypothetical protein | - |
| BM1374166_RS11830 | 487067..488465 | + | 1399 | Protein_384 | AAA family ATPase | - |
| BM1374166_RS02035 | 488614..488937 | - | 324 | WP_038473287.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| BM1374166_RS02040 | 488937..489161 | - | 225 | WP_012230987.1 | antitoxin MazE family protein | Antitoxin |
| BM1374166_RS02045 | 489384..489830 | + | 447 | WP_012230988.1 | single-stranded DNA-binding protein | - |
| BM1374166_RS02050 | 489884..490384 | + | 501 | WP_012230989.1 | hypothetical protein | - |
| BM1374166_RS02055 | 490437..490694 | + | 258 | WP_012230990.1 | antitoxin | - |
| BM1374166_RS02060 | 490691..491017 | + | 327 | WP_012230991.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| BM1374166_RS02065 | 491228..491455 | + | 228 | WP_007346764.1 | ribbon-helix-helix protein, CopG family | - |
| BM1374166_RS02070 | 491439..491708 | + | 270 | WP_012230995.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| BM1374166_RS02080 | 492257..492700 | - | 444 | WP_012231000.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 477153..595130 | 117977 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11722.87 Da Isoelectric Point: 9.3693
>T285247 WP_038473287.1 NZ_HG969192:c488937-488614 [Bartonella tribocorum]
MRGSLVTIAMQGDFGKPRPALIIQANQFSEHTSVTVLPITSTLVDTPLLRITLQPDSKNGLQKTSQVMIDKIMTVRCEKV
SPAFGSIHADKMVEIERCLAVFLGIVK
MRGSLVTIAMQGDFGKPRPALIIQANQFSEHTSVTVLPITSTLVDTPLLRITLQPDSKNGLQKTSQVMIDKIMTVRCEKV
SPAFGSIHADKMVEIERCLAVFLGIVK
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|