Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PemK-MazE
Location 488614..489161 Replicon chromosome
Accession NZ_HG969192
Organism Bartonella tribocorum strain BM1374166

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag BM1374166_RS02035 Protein ID WP_038473287.1
Coordinates 488614..488937 (-) Length 108 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A9IP98
Locus tag BM1374166_RS02040 Protein ID WP_012230987.1
Coordinates 488937..489161 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BM1374166_RS02000 483799..484401 - 603 WP_012230972.1 XRE family transcriptional regulator -
BM1374166_RS02005 484503..484748 + 246 WP_038474456.1 helix-turn-helix domain-containing protein -
BM1374166_RS02010 484792..485270 + 479 Protein_381 hypothetical protein -
BM1374166_RS02015 485260..486405 + 1146 WP_012230977.1 DUF1376 domain-containing protein -
BM1374166_RS02020 486569..486775 + 207 WP_038474459.1 hypothetical protein -
BM1374166_RS11830 487067..488465 + 1399 Protein_384 AAA family ATPase -
BM1374166_RS02035 488614..488937 - 324 WP_038473287.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
BM1374166_RS02040 488937..489161 - 225 WP_012230987.1 antitoxin MazE family protein Antitoxin
BM1374166_RS02045 489384..489830 + 447 WP_012230988.1 single-stranded DNA-binding protein -
BM1374166_RS02050 489884..490384 + 501 WP_012230989.1 hypothetical protein -
BM1374166_RS02055 490437..490694 + 258 WP_012230990.1 antitoxin -
BM1374166_RS02060 490691..491017 + 327 WP_012230991.1 type II toxin-antitoxin system PemK/MazF family toxin -
BM1374166_RS02065 491228..491455 + 228 WP_007346764.1 ribbon-helix-helix protein, CopG family -
BM1374166_RS02070 491439..491708 + 270 WP_012230995.1 type II toxin-antitoxin system RelE/ParE family toxin -
BM1374166_RS02080 492257..492700 - 444 WP_012231000.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 477153..595130 117977


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(2-102)

Antitoxin

Antitoxin MazE-like

(7-72)


Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 11722.87 Da        Isoelectric Point: 9.3693

>T285247 WP_038473287.1 NZ_HG969192:c488937-488614 [Bartonella tribocorum]
MRGSLVTIAMQGDFGKPRPALIIQANQFSEHTSVTVLPITSTLVDTPLLRITLQPDSKNGLQKTSQVMIDKIMTVRCEKV
SPAFGSIHADKMVEIERCLAVFLGIVK

Download         Length: 324 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8790.16 Da        Isoelectric Point: 8.5634

>AT285247 WP_012230987.1 NZ_HG969192:c489161-488937 [Bartonella tribocorum]
MATMHVNERVQKHRNAQRKAGLRLMQIWVPDTRQPNFAEECRRQCRLVAKMDKTDTSMQLLMDQSLMDIDGWTE

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A9IP98

References