Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pemIK/PRK09812-MazE
Location 1114347..1114936 Replicon chromosome
Accession NZ_HG969191
Organism Bartonella henselae strain BM1374165

Toxin (Protein)


Gene name pemK Uniprot ID X5M710
Locus tag BM1374165_RS04875 Protein ID WP_011180620.1
Coordinates 1114347..1114679 (-) Length 111 a.a.

Antitoxin (Protein)


Gene name pemI Uniprot ID X5MFI8
Locus tag BM1374165_RS04880 Protein ID WP_038487501.1
Coordinates 1114679..1114936 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BM1374165_RS04835 1110086..1110286 + 201 WP_034454877.1 DNA-binding protein -
BM1374165_RS04840 1110359..1111240 + 882 WP_038487768.1 toprim domain-containing protein -
BM1374165_RS04845 1111338..1112141 - 804 Protein_926 phage terminase large subunit -
BM1374165_RS04850 1112122..1112448 - 327 WP_051524333.1 hypothetical protein -
BM1374165_RS04855 1112749..1113222 + 474 Protein_928 hypothetical protein -
BM1374165_RS04860 1113295..1113729 + 435 WP_038487438.1 hypothetical protein -
BM1374165_RS04865 1113759..1114028 - 270 WP_038487435.1 type II toxin-antitoxin system RelE/ParE family toxin -
BM1374165_RS04870 1114012..1114239 - 228 WP_007346764.1 ribbon-helix-helix protein, CopG family -
BM1374165_RS04875 1114347..1114679 - 333 WP_011180620.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
BM1374165_RS04880 1114679..1114936 - 258 WP_038487501.1 antitoxin Antitoxin
BM1374165_RS04885 1115017..1115511 - 495 WP_038487773.1 hypothetical protein -
BM1374165_RS04890 1115565..1116011 - 447 WP_038487775.1 single-stranded DNA-binding protein -
BM1374165_RS04895 1116201..1116482 + 282 WP_011180826.1 type II toxin-antitoxin system RelE/ParE family toxin -
BM1374165_RS04900 1116499..1116792 + 294 WP_034447441.1 HigA family addiction module antidote protein -
BM1374165_RS04905 1116834..1117159 - 326 Protein_938 hypothetical protein -
BM1374165_RS04915 1117734..1118039 - 306 WP_011180828.1 ETC complex I subunit -
BM1374165_RS04925 1118947..1119636 - 690 WP_038487778.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(2-108)

Antitoxin

Antitoxin PemI-like

(5-84)


Sequences

Toxin        


Download         Length: 111 a.a.        Molecular weight: 11865.88 Da        Isoelectric Point: 10.5590

>T285242 WP_011180620.1 NZ_HG969191:c1114679-1114347 [Bartonella henselae]
MKRGEIWLVSLDPTSGYEQKGTRPVLIVSPEAFNRVTKTPIVLPITSGGNFSRTAGFAVSLVGTGLHTTGVIRCDQPRAL
DIAARQGKKMETVPPIIMNEVLAKLSTFLT

Download         Length: 333 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9439.75 Da        Isoelectric Point: 4.1260

>AT285242 WP_038487501.1 NZ_HG969191:c1114936-1114679 [Bartonella henselae]
MHTTKLRKVGGSVMLSIPPALLDVLHLTENTQVDLAVDNGQLVVKPQTFPSYTLDELLAQCNPSDDFADEDMEWFDAKPV
GRELL

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A067W4K9

Antitoxin

Source ID Structure
AlphaFold DB X5MFI8

References