Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pemK-pasA/PRK09812-HTH
Location 894320..894987 Replicon chromosome
Accession NZ_HG969191
Organism Bartonella henselae strain BM1374165

Toxin (Protein)


Gene name pemK Uniprot ID X5M710
Locus tag BM1374165_RS03860 Protein ID WP_011180620.1
Coordinates 894320..894652 (+) Length 111 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID N6VJG4
Locus tag BM1374165_RS03865 Protein ID WP_007346764.1
Coordinates 894760..894987 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BM1374165_RS03810 889655..889999 + 345 WP_034452646.1 DUF1376 domain-containing protein -
BM1374165_RS03815 889989..891128 + 1140 WP_038487492.1 DUF1376 domain-containing protein -
BM1374165_RS08925 891112..891498 + 387 WP_082246570.1 hypothetical protein -
BM1374165_RS03830 891680..892182 + 503 Protein_733 hypothetical protein -
BM1374165_RS03835 892187..892459 - 273 WP_011180615.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family -
BM1374165_RS03840 892456..892746 - 291 WP_038487495.1 hypothetical protein -
BM1374165_RS03845 892968..893414 + 447 WP_038487497.1 single-stranded DNA-binding protein -
BM1374165_RS03850 893470..893982 + 513 WP_172642310.1 hypothetical protein -
BM1374165_RS03855 894063..894320 + 258 WP_038487501.1 antitoxin -
BM1374165_RS03860 894320..894652 + 333 WP_011180620.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
BM1374165_RS03865 894760..894987 + 228 WP_007346764.1 ribbon-helix-helix protein, CopG family Antitoxin
BM1374165_RS03870 894971..895240 + 270 WP_038487435.1 type II toxin-antitoxin system RelE/ParE family toxin -
BM1374165_RS03875 895270..895704 - 435 WP_038487438.1 hypothetical protein -
BM1374165_RS03880 895777..896250 - 474 Protein_743 hypothetical protein -
BM1374165_RS03885 896551..896877 + 327 WP_051524333.1 hypothetical protein -
BM1374165_RS03890 896858..898002 + 1145 Protein_745 phage terminase large subunit -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 859596..897763 38167


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(2-108)

Antitoxin

Protein of unknown function DUF6290

(2-71)


Sequences

Toxin        


Download         Length: 111 a.a.        Molecular weight: 11865.88 Da        Isoelectric Point: 10.5590

>T285238 WP_011180620.1 NZ_HG969191:894320-894652 [Bartonella henselae]
MKRGEIWLVSLDPTSGYEQKGTRPVLIVSPEAFNRVTKTPIVLPITSGGNFSRTAGFAVSLVGTGLHTTGVIRCDQPRAL
DIAARQGKKMETVPPIIMNEVLAKLSTFLT

Download         Length: 333 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8742.78 Da        Isoelectric Point: 4.8780

>AT285238 WP_007346764.1 NZ_HG969191:894760-894987 [Bartonella henselae]
MTISIRLPSDLETRLNNLAAKTGRTKSFYLREIIERGIEEAEDYYLASQVRERVRRGEGTFYSSEEVRKELGLDD

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A067W4K9

Antitoxin

Source ID Structure
AlphaFold DB N6VJG4

References