Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pemK-pasA/PRK09812-HTH
Location 788669..789336 Replicon chromosome
Accession NZ_HG969191
Organism Bartonella henselae strain BM1374165

Toxin (Protein)


Gene name pemK Uniprot ID X5M710
Locus tag BM1374165_RS03335 Protein ID WP_011180620.1
Coordinates 788669..789001 (+) Length 111 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID N6VJG4
Locus tag BM1374165_RS03340 Protein ID WP_007346764.1
Coordinates 789109..789336 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BM1374165_RS03285 783787..784266 + 480 WP_011180611.1 hypothetical protein -
BM1374165_RS03290 784256..785506 + 1251 WP_038487430.1 DUF1376 domain-containing protein -
BM1374165_RS08885 785490..785876 + 387 WP_082246570.1 hypothetical protein -
BM1374165_RS03305 786058..786378 + 321 Protein_630 hypothetical protein -
BM1374165_RS03310 786566..786838 - 273 WP_011180615.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family -
BM1374165_RS03315 786835..787125 - 291 WP_011180616.1 hypothetical protein -
BM1374165_RS03320 787337..787783 + 447 WP_011180617.1 single-stranded DNA-binding protein -
BM1374165_RS03325 787837..788331 + 495 WP_034448601.1 hypothetical protein -
BM1374165_RS03330 788412..788669 + 258 WP_034459411.1 antitoxin -
BM1374165_RS03335 788669..789001 + 333 WP_011180620.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
BM1374165_RS03340 789109..789336 + 228 WP_007346764.1 ribbon-helix-helix protein, CopG family Antitoxin
BM1374165_RS03345 789320..789589 + 270 WP_038487435.1 type II toxin-antitoxin system RelE/ParE family toxin -
BM1374165_RS03350 789619..790053 - 435 WP_038487438.1 hypothetical protein -
BM1374165_RS03355 790126..790599 - 474 Protein_640 hypothetical protein -
BM1374165_RS03360 790900..791226 + 327 WP_051523598.1 hypothetical protein -
BM1374165_RS03365 791207..792346 + 1140 WP_051523599.1 phage terminase large subunit -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 764972..792346 27374


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(2-108)

Antitoxin

Protein of unknown function DUF6290

(2-71)


Sequences

Toxin        


Download         Length: 111 a.a.        Molecular weight: 11865.88 Da        Isoelectric Point: 10.5590

>T285234 WP_011180620.1 NZ_HG969191:788669-789001 [Bartonella henselae]
MKRGEIWLVSLDPTSGYEQKGTRPVLIVSPEAFNRVTKTPIVLPITSGGNFSRTAGFAVSLVGTGLHTTGVIRCDQPRAL
DIAARQGKKMETVPPIIMNEVLAKLSTFLT

Download         Length: 333 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8742.78 Da        Isoelectric Point: 4.8780

>AT285234 WP_007346764.1 NZ_HG969191:789109-789336 [Bartonella henselae]
MTISIRLPSDLETRLNNLAAKTGRTKSFYLREIIERGIEEAEDYYLASQVRERVRRGEGTFYSSEEVRKELGLDD

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A067W4K9

Antitoxin

Source ID Structure
AlphaFold DB N6VJG4

References