Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-parD/RelE-RHH
Location 786566..787125 Replicon chromosome
Accession NZ_HG969191
Organism Bartonella henselae strain BM1374165

Toxin (Protein)


Gene name relE Uniprot ID X5M706
Locus tag BM1374165_RS03310 Protein ID WP_011180615.1
Coordinates 786566..786838 (-) Length 91 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID X5LVL8
Locus tag BM1374165_RS03315 Protein ID WP_011180616.1
Coordinates 786835..787125 (-) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BM1374165_RS03265 781890..782264 - 375 WP_011180607.1 hypothetical protein -
BM1374165_RS03270 782503..782772 - 270 WP_099358259.1 hypothetical protein -
BM1374165_RS03275 782998..783201 + 204 Protein_625 hypothetical protein -
BM1374165_RS03280 783291..783650 + 360 WP_011180610.1 hypothetical protein -
BM1374165_RS03285 783787..784266 + 480 WP_011180611.1 hypothetical protein -
BM1374165_RS03290 784256..785506 + 1251 WP_038487430.1 DUF1376 domain-containing protein -
BM1374165_RS08885 785490..785876 + 387 WP_082246570.1 hypothetical protein -
BM1374165_RS03305 786058..786378 + 321 Protein_630 hypothetical protein -
BM1374165_RS03310 786566..786838 - 273 WP_011180615.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
BM1374165_RS03315 786835..787125 - 291 WP_011180616.1 hypothetical protein Antitoxin
BM1374165_RS03320 787337..787783 + 447 WP_011180617.1 single-stranded DNA-binding protein -
BM1374165_RS03325 787837..788331 + 495 WP_034448601.1 hypothetical protein -
BM1374165_RS03330 788412..788669 + 258 WP_034459411.1 antitoxin -
BM1374165_RS03335 788669..789001 + 333 WP_011180620.1 type II toxin-antitoxin system PemK/MazF family toxin -
BM1374165_RS03340 789109..789336 + 228 WP_007346764.1 ribbon-helix-helix protein, CopG family -
BM1374165_RS03345 789320..789589 + 270 WP_038487435.1 type II toxin-antitoxin system RelE/ParE family toxin -
BM1374165_RS03350 789619..790053 - 435 WP_038487438.1 hypothetical protein -
BM1374165_RS03355 790126..790599 - 474 Protein_640 hypothetical protein -
BM1374165_RS03360 790900..791226 + 327 WP_051523598.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 764972..792346 27374


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-89)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 91 a.a.        Molecular weight: 10747.75 Da        Isoelectric Point: 11.3976

>T285232 WP_011180615.1 NZ_HG969191:c786838-786566 [Bartonella henselae]
MKLVWTRIAHYDRQKIREYIAQENPSAALVFDKLLSKKVERLISFPNLGRVGRIRNTRELIVRKNYIMIYDVSNGTIRVL
RILHAKQKWP

Download         Length: 273 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 11099.43 Da        Isoelectric Point: 4.5837

>AT285232 WP_011180616.1 NZ_HG969191:c787125-786835 [Bartonella henselae]
MAETTFTFRVDDALKSEFSQAAKACDRSAAQLLRDYMRDIVKEQKEKIAHELWFQEQVQLGLNSANAGDVIPFEEIETEA
QAWRFEIQRKLKTSDS

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A067W4L5

Antitoxin

Source ID Structure
AlphaFold DB A0A067W521

References