Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 389050..389642 | Replicon | chromosome |
| Accession | NZ_HG969191 | ||
| Organism | Bartonella henselae strain BM1374165 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | BM1374165_RS08825 | Protein ID | WP_038487070.1 |
| Coordinates | 389466..389642 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicA | Uniprot ID | X5MGF4 |
| Locus tag | BM1374165_RS01610 | Protein ID | WP_038487068.1 |
| Coordinates | 389050..389445 (-) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BM1374165_RS01580 | 384288..384566 | - | 279 | WP_038487059.1 | hypothetical protein | - |
| BM1374165_RS01585 | 384563..385321 | - | 759 | WP_038487061.1 | antA/AntB antirepressor family protein | - |
| BM1374165_RS01590 | 385616..386179 | - | 564 | Protein_300 | antA/AntB antirepressor family protein | - |
| BM1374165_RS01595 | 386757..387347 | - | 591 | WP_038487063.1 | antA/AntB antirepressor family protein | - |
| BM1374165_RS01600 | 387675..388253 | - | 579 | WP_038487065.1 | hypothetical protein | - |
| BM1374165_RS01605 | 388257..388577 | - | 321 | WP_038487067.1 | hypothetical protein | - |
| BM1374165_RS01610 | 389050..389445 | - | 396 | WP_038487068.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| BM1374165_RS08825 | 389466..389642 | - | 177 | WP_038487070.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| BM1374165_RS01620 | 389707..390243 | - | 537 | WP_038487071.1 | hypothetical protein | - |
| BM1374165_RS01625 | 390254..390700 | - | 447 | WP_011180293.1 | single-stranded DNA-binding protein | - |
| BM1374165_RS01630 | 390891..391172 | + | 282 | WP_011180826.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| BM1374165_RS01635 | 391189..391482 | + | 294 | WP_034447441.1 | HigA family addiction module antidote protein | - |
| BM1374165_RS01640 | 391524..391850 | - | 327 | WP_034447437.1 | hypothetical protein | - |
| BM1374165_RS01645 | 392015..392434 | - | 420 | WP_034447433.1 | hypothetical protein | - |
| BM1374165_RS01650 | 392427..393494 | - | 1068 | WP_038487076.1 | DUF1376 domain-containing protein | - |
| BM1374165_RS01655 | 393484..393828 | - | 345 | WP_034452646.1 | DUF1376 domain-containing protein | - |
| BM1374165_RS01660 | 393818..394300 | - | 483 | WP_038487079.1 | phage related protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 361130..408510 | 47380 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6439.63 Da Isoelectric Point: 11.2068
>T285231 WP_038487070.1 NZ_HG969191:c389642-389466 [Bartonella henselae]
MEQNSRKIIAKLKRDGFELVKVKGSHHKFKKDGKVVIVPHPKKNLPIGTAHSIAQQAG
MEQNSRKIIAKLKRDGFELVKVKGSHHKFKKDGKVVIVPHPKKNLPIGTAHSIAQQAG
Download Length: 177 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14705.71 Da Isoelectric Point: 4.3191
>AT285231 WP_038487068.1 NZ_HG969191:c389445-389050 [Bartonella henselae]
MKRFFALVHKDEDSAFGVQFPDFEGLFSAADEEETLIINATEALQLYCEDMDTVPVPLKFEEVIQQKAVKKALSEGAFLI
QVPFIENDSEVVRTNISIERGLLRAIDNCAQERGLTRSAFLATAARHELNI
MKRFFALVHKDEDSAFGVQFPDFEGLFSAADEEETLIINATEALQLYCEDMDTVPVPLKFEEVIQQKAVKKALSEGAFLI
QVPFIENDSEVVRTNISIERGLLRAIDNCAQERGLTRSAFLATAARHELNI
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|