Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-RelB
Location 383714..384245 Replicon chromosome
Accession NZ_HG969191
Organism Bartonella henselae strain BM1374165

Toxin (Protein)


Gene name relE Uniprot ID X5M5T9
Locus tag BM1374165_RS01575 Protein ID WP_011180281.1
Coordinates 383964..384245 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID X5M3D1
Locus tag BM1374165_RS01570 Protein ID WP_038487057.1
Coordinates 383714..383977 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BM1374165_RS01545 379858..380106 - 249 WP_038487052.1 phage related protein -
BM1374165_RS01550 380110..382041 - 1932 WP_038487054.1 phage terminase large subunit family protein -
BM1374165_RS01555 382034..382615 - 582 WP_038488823.1 hypothetical protein -
BM1374165_RS01560 382678..382992 + 315 WP_038487056.1 type II toxin-antitoxin system RelE/ParE family toxin -
BM1374165_RS01565 383009..383305 + 297 WP_034454130.1 HigA family addiction module antidote protein -
BM1374165_RS01570 383714..383977 + 264 WP_038487057.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
BM1374165_RS01575 383964..384245 + 282 WP_011180281.1 type II toxin-antitoxin system YafQ family toxin Toxin
BM1374165_RS01580 384288..384566 - 279 WP_038487059.1 hypothetical protein -
BM1374165_RS01585 384563..385321 - 759 WP_038487061.1 antA/AntB antirepressor family protein -
BM1374165_RS01590 385616..386179 - 564 Protein_300 antA/AntB antirepressor family protein -
BM1374165_RS01595 386757..387347 - 591 WP_038487063.1 antA/AntB antirepressor family protein -
BM1374165_RS01600 387675..388253 - 579 WP_038487065.1 hypothetical protein -
BM1374165_RS01605 388257..388577 - 321 WP_038487067.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 361130..408510 47380


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(2-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-83)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11106.85 Da        Isoelectric Point: 10.3380

>T285230 WP_011180281.1 NZ_HG969191:383964-384245 [Bartonella henselae]
MRTIERTTIFKRDFKREMKGQHRHLLDTDLRKVIAALANDQPLEIRYRDHALTGNWSNYRDCHIRPDLVLIYRLIGQDRL
VLVRLGSHSQLDL

Download         Length: 282 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9623.89 Da        Isoelectric Point: 4.1403

>AT285230 WP_038487057.1 NZ_HG969191:383714-383977 [Bartonella henselae]
MATSRMVQARVPEEIQNVASQVIQASGLSVSDVVRVLMTRIAQDKAIPPFLFQPNAETIAAFAELDEGNLKKFHSVDELF
DDLYADD

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0R4J6H3

Antitoxin

Source ID Structure
AlphaFold DB X5M3D1

References