Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PemK-MazE
Location 371069..371616 Replicon chromosome
Accession NZ_HG969191
Organism Bartonella henselae strain BM1374165

Toxin (Protein)


Gene name mazF Uniprot ID X5MEL7
Locus tag BM1374165_RS01485 Protein ID WP_038488820.1
Coordinates 371293..371616 (+) Length 108 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID X5M631
Locus tag BM1374165_RS01480 Protein ID WP_038487033.1
Coordinates 371069..371293 (+) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BM1374165_RS01435 366186..366556 + 371 Protein_270 XRE family transcriptional regulator -
BM1374165_RS01440 366865..368022 + 1158 WP_038487027.1 integrase arm-type DNA-binding domain-containing protein -
BM1374165_RS01445 368294..368885 + 592 Protein_272 antA/AntB antirepressor family protein -
BM1374165_RS01450 369006..369281 + 276 WP_011180235.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
BM1374165_RS01455 369294..369575 + 282 WP_038487029.1 type II toxin-antitoxin system YafQ family toxin -
BM1374165_RS01460 369698..369910 - 213 WP_034447463.1 hypothetical protein -
BM1374165_RS01470 370039..370266 - 228 WP_038487030.1 hypothetical protein -
BM1374165_RS01475 370263..370925 - 663 WP_034454969.1 glycoside hydrolase family protein -
BM1374165_RS01480 371069..371293 + 225 WP_038487033.1 antitoxin MazE family protein Antitoxin
BM1374165_RS01485 371293..371616 + 324 WP_038488820.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
BM1374165_RS01490 371617..371835 + 219 WP_038487034.1 hypothetical protein -
BM1374165_RS01495 371862..372140 - 279 WP_038487036.1 hypothetical protein -
BM1374165_RS01500 372137..372865 - 729 WP_038487038.1 antA/AntB antirepressor family protein -
BM1374165_RS01505 373119..373691 - 573 WP_038487041.1 antA/AntB antirepressor family protein -
BM1374165_RS01510 374075..375148 + 1074 WP_038487043.1 hypothetical protein -
BM1374165_RS01515 375184..375537 - 354 WP_038487045.1 hypothetical protein -
BM1374165_RS01520 375539..376615 - 1077 WP_038487047.1 major capsid protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 361130..408510 47380


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(2-102)

Antitoxin

Antitoxin MazE-like

(7-72)


Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 11763.04 Da        Isoelectric Point: 9.3693

>T285228 WP_038488820.1 NZ_HG969191:371293-371616 [Bartonella henselae]
MRGSLVTIAMQGDFGKPRPALIIQANQFSEHTSVMVLPITSTLIDAPLLRITVQPDAKNGLQKPSQVMIDKIMTVRCEKV
SPAFGFIHADKMVEIERCLAVFLGIVK

Download         Length: 324 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8772.17 Da        Isoelectric Point: 9.4438

>AT285228 WP_038487033.1 NZ_HG969191:371069-371293 [Bartonella henselae]
MATMHVNERVQKHRNAQRKAGLRLIQIWVPDTRQPNFAEECRRQCRLVAKMDKTDTSMQLLMDKSLMDIDGWTE

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB X5MEL7

Antitoxin

Source ID Structure
AlphaFold DB X5M631

References