Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemK-pasA/PRK09812-HTH |
| Location | 812278..812945 | Replicon | chromosome |
| Accession | NZ_HG965802 | ||
| Organism | Bartonella henselae strain BM1374163 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | X5M710 |
| Locus tag | PRJBM_RS03445 | Protein ID | WP_011180620.1 |
| Coordinates | 812278..812610 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pasA | Uniprot ID | N6VJG4 |
| Locus tag | PRJBM_RS03450 | Protein ID | WP_007346764.1 |
| Coordinates | 812718..812945 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PRJBM_RS03395 | 807396..807875 | + | 480 | WP_011180611.1 | hypothetical protein | - |
| PRJBM_RS03400 | 807865..809115 | + | 1251 | WP_034448599.1 | DUF1376 domain-containing protein | - |
| PRJBM_RS08545 | 809099..809485 | + | 387 | WP_082246570.1 | hypothetical protein | - |
| PRJBM_RS03415 | 809667..809987 | + | 321 | Protein_658 | hypothetical protein | - |
| PRJBM_RS03420 | 810175..810447 | - | 273 | WP_011180615.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
| PRJBM_RS03425 | 810444..810734 | - | 291 | WP_011180616.1 | hypothetical protein | - |
| PRJBM_RS03430 | 810946..811392 | + | 447 | WP_011180617.1 | single-stranded DNA-binding protein | - |
| PRJBM_RS03435 | 811446..811940 | + | 495 | WP_034448601.1 | hypothetical protein | - |
| PRJBM_RS03440 | 812021..812278 | + | 258 | WP_034459411.1 | antitoxin | - |
| PRJBM_RS03445 | 812278..812610 | + | 333 | WP_011180620.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PRJBM_RS03450 | 812718..812945 | + | 228 | WP_007346764.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| PRJBM_RS03455 | 812929..813198 | + | 270 | WP_011180622.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PRJBM_RS03460 | 813716..814174 | - | 459 | WP_011180624.1 | hypothetical protein | - |
| PRJBM_RS03465 | 814473..814799 | + | 327 | WP_051523598.1 | hypothetical protein | - |
| PRJBM_RS03470 | 814780..815919 | + | 1140 | WP_051523599.1 | phage terminase large subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 788581..815919 | 27338 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11865.88 Da Isoelectric Point: 10.5590
>T285225 WP_011180620.1 NZ_HG965802:812278-812610 [Bartonella henselae]
MKRGEIWLVSLDPTSGYEQKGTRPVLIVSPEAFNRVTKTPIVLPITSGGNFSRTAGFAVSLVGTGLHTTGVIRCDQPRAL
DIAARQGKKMETVPPIIMNEVLAKLSTFLT
MKRGEIWLVSLDPTSGYEQKGTRPVLIVSPEAFNRVTKTPIVLPITSGGNFSRTAGFAVSLVGTGLHTTGVIRCDQPRAL
DIAARQGKKMETVPPIIMNEVLAKLSTFLT
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A067W4K9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | N6VJG4 |