Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pemK-pasA/PRK09812-HTH
Location 812278..812945 Replicon chromosome
Accession NZ_HG965802
Organism Bartonella henselae strain BM1374163

Toxin (Protein)


Gene name pemK Uniprot ID X5M710
Locus tag PRJBM_RS03445 Protein ID WP_011180620.1
Coordinates 812278..812610 (+) Length 111 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID N6VJG4
Locus tag PRJBM_RS03450 Protein ID WP_007346764.1
Coordinates 812718..812945 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PRJBM_RS03395 807396..807875 + 480 WP_011180611.1 hypothetical protein -
PRJBM_RS03400 807865..809115 + 1251 WP_034448599.1 DUF1376 domain-containing protein -
PRJBM_RS08545 809099..809485 + 387 WP_082246570.1 hypothetical protein -
PRJBM_RS03415 809667..809987 + 321 Protein_658 hypothetical protein -
PRJBM_RS03420 810175..810447 - 273 WP_011180615.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family -
PRJBM_RS03425 810444..810734 - 291 WP_011180616.1 hypothetical protein -
PRJBM_RS03430 810946..811392 + 447 WP_011180617.1 single-stranded DNA-binding protein -
PRJBM_RS03435 811446..811940 + 495 WP_034448601.1 hypothetical protein -
PRJBM_RS03440 812021..812278 + 258 WP_034459411.1 antitoxin -
PRJBM_RS03445 812278..812610 + 333 WP_011180620.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
PRJBM_RS03450 812718..812945 + 228 WP_007346764.1 ribbon-helix-helix protein, CopG family Antitoxin
PRJBM_RS03455 812929..813198 + 270 WP_011180622.1 type II toxin-antitoxin system RelE/ParE family toxin -
PRJBM_RS03460 813716..814174 - 459 WP_011180624.1 hypothetical protein -
PRJBM_RS03465 814473..814799 + 327 WP_051523598.1 hypothetical protein -
PRJBM_RS03470 814780..815919 + 1140 WP_051523599.1 phage terminase large subunit -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 788581..815919 27338


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(2-108)

Antitoxin

Protein of unknown function DUF6290

(2-71)


Sequences

Toxin        


Download         Length: 111 a.a.        Molecular weight: 11865.88 Da        Isoelectric Point: 10.5590

>T285225 WP_011180620.1 NZ_HG965802:812278-812610 [Bartonella henselae]
MKRGEIWLVSLDPTSGYEQKGTRPVLIVSPEAFNRVTKTPIVLPITSGGNFSRTAGFAVSLVGTGLHTTGVIRCDQPRAL
DIAARQGKKMETVPPIIMNEVLAKLSTFLT

Download         Length: 333 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8742.78 Da        Isoelectric Point: 4.8780

>AT285225 WP_007346764.1 NZ_HG965802:812718-812945 [Bartonella henselae]
MTISIRLPSDLETRLNNLAAKTGRTKSFYLREIIERGIEEAEDYYLASQVRERVRRGEGTFYSSEEVRKELGLDD

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A067W4K9

Antitoxin

Source ID Structure
AlphaFold DB N6VJG4

References