Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-parD/RelE-RHH
Location 810175..810734 Replicon chromosome
Accession NZ_HG965802
Organism Bartonella henselae strain BM1374163

Toxin (Protein)


Gene name relE Uniprot ID X5M706
Locus tag PRJBM_RS03420 Protein ID WP_011180615.1
Coordinates 810175..810447 (-) Length 91 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID X5LVL8
Locus tag PRJBM_RS03425 Protein ID WP_011180616.1
Coordinates 810444..810734 (-) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PRJBM_RS03375 805499..805873 - 375 WP_011180607.1 hypothetical protein -
PRJBM_RS03380 806112..806381 - 270 WP_099358259.1 hypothetical protein -
PRJBM_RS03385 806607..806810 + 204 Protein_653 hypothetical protein -
PRJBM_RS03390 806900..807259 + 360 WP_011180610.1 hypothetical protein -
PRJBM_RS03395 807396..807875 + 480 WP_011180611.1 hypothetical protein -
PRJBM_RS03400 807865..809115 + 1251 WP_034448599.1 DUF1376 domain-containing protein -
PRJBM_RS08545 809099..809485 + 387 WP_082246570.1 hypothetical protein -
PRJBM_RS03415 809667..809987 + 321 Protein_658 hypothetical protein -
PRJBM_RS03420 810175..810447 - 273 WP_011180615.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
PRJBM_RS03425 810444..810734 - 291 WP_011180616.1 hypothetical protein Antitoxin
PRJBM_RS03430 810946..811392 + 447 WP_011180617.1 single-stranded DNA-binding protein -
PRJBM_RS03435 811446..811940 + 495 WP_034448601.1 hypothetical protein -
PRJBM_RS03440 812021..812278 + 258 WP_034459411.1 antitoxin -
PRJBM_RS03445 812278..812610 + 333 WP_011180620.1 type II toxin-antitoxin system PemK/MazF family toxin -
PRJBM_RS03450 812718..812945 + 228 WP_007346764.1 ribbon-helix-helix protein, CopG family -
PRJBM_RS03455 812929..813198 + 270 WP_011180622.1 type II toxin-antitoxin system RelE/ParE family toxin -
PRJBM_RS03460 813716..814174 - 459 WP_011180624.1 hypothetical protein -
PRJBM_RS03465 814473..814799 + 327 WP_051523598.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 788581..815919 27338


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-89)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 91 a.a.        Molecular weight: 10747.75 Da        Isoelectric Point: 11.3976

>T285223 WP_011180615.1 NZ_HG965802:c810447-810175 [Bartonella henselae]
MKLVWTRIAHYDRQKIREYIAQENPSAALVFDKLLSKKVERLISFPNLGRVGRIRNTRELIVRKNYIMIYDVSNGTIRVL
RILHAKQKWP

Download         Length: 273 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 11099.43 Da        Isoelectric Point: 4.5837

>AT285223 WP_011180616.1 NZ_HG965802:c810734-810444 [Bartonella henselae]
MAETTFTFRVDDALKSEFSQAAKACDRSAAQLLRDYMRDIVKEQKEKIAHELWFQEQVQLGLNSANAGDVIPFEEIETEA
QAWRFEIQRKLKTSDS

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A067W4L5

Antitoxin

Source ID Structure
AlphaFold DB A0A067W521

References