Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 412692..413284 | Replicon | chromosome |
| Accession | NZ_HG965802 | ||
| Organism | Bartonella henselae strain BM1374163 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A829Z6B5 |
| Locus tag | PRJBM_RS01715 | Protein ID | WP_034447446.1 |
| Coordinates | 413084..413284 (-) | Length | 67 a.a. |
Antitoxin (Protein)
| Gene name | hicA | Uniprot ID | A0A840E534 |
| Locus tag | PRJBM_RS01710 | Protein ID | WP_011180290.1 |
| Coordinates | 412692..413087 (-) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PRJBM_RS01680 | 407957..408715 | - | 759 | WP_011180282.1 | phage antirepressor Ant | - |
| PRJBM_RS01685 | 408775..409290 | - | 516 | WP_011180283.1 | phage antirepressor Ant | - |
| PRJBM_RS01690 | 409583..410146 | - | 564 | Protein_328 | antA/AntB antirepressor family protein | - |
| PRJBM_RS01695 | 410178..410720 | - | 543 | WP_011180285.1 | phage antirepressor Ant | - |
| PRJBM_RS01700 | 411317..411895 | - | 579 | WP_011180287.1 | hypothetical protein | - |
| PRJBM_RS01705 | 411899..412219 | - | 321 | WP_011180288.1 | hypothetical protein | - |
| PRJBM_RS01710 | 412692..413087 | - | 396 | WP_011180290.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PRJBM_RS01715 | 413084..413284 | - | 201 | WP_034447446.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PRJBM_RS01720 | 413349..413885 | - | 537 | WP_034447444.1 | hypothetical protein | - |
| PRJBM_RS01725 | 413896..414342 | - | 447 | WP_011180293.1 | single-stranded DNA-binding protein | - |
| PRJBM_RS01730 | 414533..414814 | + | 282 | WP_011180826.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PRJBM_RS01735 | 414831..415124 | + | 294 | WP_034447441.1 | HigA family addiction module antidote protein | - |
| PRJBM_RS01740 | 415166..415492 | - | 327 | WP_034447437.1 | hypothetical protein | - |
| PRJBM_RS01745 | 415657..416076 | - | 420 | WP_038525124.1 | hypothetical protein | - |
| PRJBM_RS01750 | 416069..417181 | - | 1113 | WP_011180297.1 | DUF1376 domain-containing protein | - |
| PRJBM_RS01755 | 417171..417518 | - | 348 | WP_011180298.1 | DUF1376 domain-containing protein | - |
| PRJBM_RS01760 | 417511..417987 | - | 477 | WP_011180299.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 362344..432004 | 69660 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 67 a.a. Molecular weight: 7492.81 Da Isoelectric Point: 10.9914
>T285222 WP_034447446.1 NZ_HG965802:c413284-413084 [Bartonella henselae]
MEQNSRKIIAKLKRDGFELVKVKGSHHKFKKDGKVVIVPHPKKNLPIGTARSIAQQAGWFKKGEEE
MEQNSRKIIAKLKRDGFELVKVKGSHHKFKKDGKVVIVPHPKKNLPIGTARSIAQQAGWFKKGEEE
Download Length: 201 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14718.71 Da Isoelectric Point: 4.3191
>AT285222 WP_011180290.1 NZ_HG965802:c413087-412692 [Bartonella henselae]
MKRFFALVHKDEDSAFGVQFPDFEGLFSAADEEENLIINATEALQLYCEDMDTVPVPLKFEEVIQQKAVKKALSEGAFLI
QVPFIENDSEVVRTNISIERGLLRAIDNCAQERGLTRSAFLATAARHELNI
MKRFFALVHKDEDSAFGVQFPDFEGLFSAADEEENLIINATEALQLYCEDMDTVPVPLKFEEVIQQKAVKKALSEGAFLI
QVPFIENDSEVVRTNISIERGLLRAIDNCAQERGLTRSAFLATAARHELNI
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829Z6B5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A840E534 |