Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 124021..124664 Replicon plasmid pEC958
Accession NZ_HG941719
Organism Escherichia coli O25b:H4-ST131 strain EC958

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag EC958_RS26310 Protein ID WP_001034044.1
Coordinates 124021..124437 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag EC958_RS26315 Protein ID WP_001261286.1
Coordinates 124434..124664 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EC958_RS26290 119827..120134 + 308 Protein_137 type II toxin-antitoxin system ParD family antitoxin -
EC958_RS26295 120423..121120 + 698 Protein_138 IS1 family transposase -
EC958_RS26300 121374..122396 - 1023 WP_000361402.1 helicase UvrD -
EC958_RS26305 122381..123946 - 1566 WP_001128474.1 AAA family ATPase -
EC958_RS26310 124021..124437 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
EC958_RS26315 124434..124664 - 231 WP_001261286.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
EC958_RS26320 125045..128839 + 3795 WP_001144732.1 hypothetical protein -
EC958_RS26325 128884..129300 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -
EC958_RS26330 129297..129527 - 231 WP_001261278.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / aadA5 / qacE / sul1 / mph(A) / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr / tet(A) - 1..135602 135602
- flank IS/Tn - - 120617..121120 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T285218 WP_001034044.1 NZ_HG941719:c124437-124021 [Escherichia coli O25b:H4-ST131]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT285218 WP_001261286.1 NZ_HG941719:c124664-124434 [Escherichia coli O25b:H4-ST131]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References