Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 5055662..5056238 | Replicon | chromosome |
Accession | NZ_HG941718 | ||
Organism | Escherichia coli O25b:H4-ST131 strain EC958 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | A0A061KXE4 |
Locus tag | EC958_RS25275 | Protein ID | WP_001295743.1 |
Coordinates | 5055662..5055949 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A066STF6 |
Locus tag | EC958_RS25280 | Protein ID | WP_000063148.1 |
Coordinates | 5055936..5056238 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EC958_RS25260 | 5051322..5052626 | - | 1305 | WP_000535012.1 | restriction endonuclease subunit S | - |
EC958_RS25265 | 5052616..5054235 | - | 1620 | WP_001029745.1 | type I restriction-modification system subunit M | - |
EC958_RS25270 | 5054299..5055465 | - | 1167 | WP_000800831.1 | restriction endonuclease | - |
EC958_RS25275 | 5055662..5055949 | + | 288 | WP_001295743.1 | BrnT family toxin | Toxin |
EC958_RS25280 | 5055936..5056238 | + | 303 | WP_000063148.1 | BrnA antitoxin family protein | Antitoxin |
EC958_RS25285 | 5056272..5057228 | - | 957 | WP_001295745.1 | GTPase | - |
EC958_RS25290 | 5057239..5057442 | - | 204 | WP_000467859.1 | YbdD/YjiX family protein | - |
EC958_RS25295 | 5057492..5059642 | - | 2151 | WP_001295524.1 | pyruvate/proton symporter BtsT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11156.62 Da Isoelectric Point: 7.4697
>T285212 WP_001295743.1 NZ_HG941718:5055662-5055949 [Escherichia coli O25b:H4-ST131]
MPMEFEWDANKAKSNRVKHGIRFEDAVLVFDDPQHLSQQDRIENGEYRWQTIGLVHGIVVILVAHTIRFESGNEIIRIIS
ARKADRKERSRYEHG
MPMEFEWDANKAKSNRVKHGIRFEDAVLVFDDPQHLSQQDRIENGEYRWQTIGLVHGIVVILVAHTIRFESGNEIIRIIS
ARKADRKERSRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061KXE4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A066STF6 |