Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 5005981..5006801 | Replicon | chromosome |
Accession | NZ_HG941718 | ||
Organism | Escherichia coli O25b:H4-ST131 strain EC958 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | B6I030 |
Locus tag | EC958_RS25020 | Protein ID | WP_001054379.1 |
Coordinates | 5006544..5006801 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | - |
Locus tag | EC958_RS25015 | Protein ID | WP_000123957.1 |
Coordinates | 5005981..5006532 (-) | Length | 184 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EC958_RS24990 | 5001675..5002988 | - | 1314 | WP_000460845.1 | galactitol-specific PTS transporter subunit IIC | - |
EC958_RS24995 | 5003000..5003278 | - | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB | - |
EC958_RS25000 | 5003275..5004396 | - | 1122 | WP_000010833.1 | M42 family metallopeptidase | - |
EC958_RS29725 | 5004641..5004757 | - | 117 | Protein_4727 | VOC family protein | - |
EC958_RS25005 | 5004795..5005055 | - | 261 | WP_000077645.1 | hypothetical protein | - |
EC958_RS25010 | 5005183..5005929 | - | 747 | WP_000354249.1 | class I SAM-dependent methyltransferase | - |
EC958_RS25015 | 5005981..5006532 | - | 552 | WP_000123957.1 | N-acetyltransferase | Antitoxin |
EC958_RS25020 | 5006544..5006801 | - | 258 | WP_001054379.1 | YjhX family toxin | Toxin |
EC958_RS28255 | 5007178..5007342 | - | 165 | Protein_4732 | GNAT family N-acetyltransferase | - |
EC958_RS25035 | 5008585..5009691 | + | 1107 | Protein_4734 | helicase YjhR | - |
EC958_RS25040 | 5010274..5011254 | - | 981 | WP_000991462.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9568.07 Da Isoelectric Point: 11.1381
>T285211 WP_001054379.1 NZ_HG941718:c5006801-5006544 [Escherichia coli O25b:H4-ST131]
MNLSRQEQRTLHVLAKGGRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
MNLSRQEQRTLHVLAKGGRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 184 a.a. Molecular weight: 20358.34 Da Isoelectric Point: 6.4182
>AT285211 WP_000123957.1 NZ_HG941718:c5006532-5005981 [Escherichia coli O25b:H4-ST131]
MTAHHFTFQITDESDASDIREVETRAFGFSKEADLTASLLEDESARPALSLLARHEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQALTA
QPMNVTGHIQCAQALMKPEHWRE
MTAHHFTFQITDESDASDIREVETRAFGFSKEADLTASLLEDESARPALSLLARHEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQALTA
QPMNVTGHIQCAQALMKPEHWRE
Download Length: 552 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|