Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3355817..3356651 Replicon chromosome
Accession NZ_HG941718
Organism Escherichia coli O25b:H4-ST131 strain EC958

Toxin (Protein)


Gene name yeeV Uniprot ID A0A8E0IX31
Locus tag EC958_RS16915 Protein ID WP_000854689.1
Coordinates 3356274..3356651 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A1X3JHN3
Locus tag EC958_RS16910 Protein ID WP_001285598.1
Coordinates 3355817..3356197 (+) Length 127 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EC958_RS16875 3352100..3352555 + 456 WP_000581502.1 hypothetical protein -
EC958_RS16880 3352660..3352869 + 210 WP_032142237.1 DUF905 family protein -
EC958_RS16885 3352970..3353788 + 819 WP_001234620.1 DUF945 domain-containing protein -
EC958_RS16890 3353843..3354328 + 486 WP_000849566.1 antirestriction protein -
EC958_RS16895 3354344..3354820 + 477 WP_001186726.1 RadC family protein -
EC958_RS16900 3354883..3355104 + 222 WP_000692329.1 DUF987 domain-containing protein -
EC958_RS16905 3355123..3355767 + 645 WP_000094916.1 hypothetical protein -
EC958_RS16910 3355817..3356197 + 381 WP_001285598.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
EC958_RS16915 3356274..3356651 + 378 WP_000854689.1 TA system toxin CbtA family protein Toxin
EC958_RS16920 3356648..3357136 + 489 WP_000761699.1 hypothetical protein -
EC958_RS16925 3357153..3357350 + 198 WP_000839293.1 DUF957 domain-containing protein -
EC958_RS16930 3357435..3358280 + 846 WP_023281696.1 DUF4942 domain-containing protein -
EC958_RS16935 3358349..3358744 + 396 WP_000208383.1 type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein -
EC958_RS16940 3358737..3359630 + 894 WP_001114681.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
EC958_RS16945 3360101..3360271 + 171 Protein_3224 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14042.07 Da        Isoelectric Point: 9.1510

>T285201 WP_000854689.1 NZ_HG941718:3356274-3356651 [Escherichia coli O25b:H4-ST131]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 127 a.a.        Molecular weight: 13927.72 Da        Isoelectric Point: 4.7959

>AT285201 WP_001285598.1 NZ_HG941718:3355817-3356197 [Escherichia coli O25b:H4-ST131]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE

Download         Length: 381 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A1X3JHN3

References