Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 2070369..2071111 | Replicon | chromosome |
Accession | NZ_HG938371 | ||
Organism | Burkholderia cenocepacia H111 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | I35_RS25615 | Protein ID | WP_006496180.1 |
Coordinates | 2070369..2070881 (-) | Length | 171 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | I35_RS25620 | Protein ID | WP_046338145.1 |
Coordinates | 2070878..2071111 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
I35_RS25590 | 2065912..2066709 | + | 798 | WP_006496182.1 | AraC family transcriptional regulator | - |
I35_RS25595 | 2066888..2067820 | + | 933 | WP_006496181.1 | DMT family transporter | - |
I35_RS25600 | 2068024..2068572 | + | 549 | WP_006485834.1 | hypothetical protein | - |
I35_RS25605 | 2068667..2068801 | - | 135 | WP_006485835.1 | entericidin A/B family lipoprotein | - |
I35_RS25610 | 2069036..2070331 | + | 1296 | WP_006485851.1 | aspartate carbamoyltransferase | - |
I35_RS25615 | 2070369..2070881 | - | 513 | WP_006496180.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
I35_RS25620 | 2070878..2071111 | - | 234 | WP_046338145.1 | plasmid stability protein | Antitoxin |
I35_RS25625 | 2071413..2073656 | + | 2244 | WP_006496178.1 | TonB-dependent siderophore receptor | - |
I35_RS25630 | 2073660..2074415 | + | 756 | WP_006496177.1 | sel1 repeat family protein | - |
I35_RS25635 | 2074412..2075095 | + | 684 | WP_006496176.1 | Fe2+-dependent dioxygenase | - |
I35_RS25640 | 2075164..2075403 | + | 240 | WP_006496175.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
I35_RS25645 | 2075616..2075870 | + | 255 | WP_006496174.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 171 a.a. Molecular weight: 18730.70 Da Isoelectric Point: 11.3840
>T285182 WP_006496180.1 NZ_HG938371:c2070881-2070369 [Burkholderia cenocepacia H111]
MIPVDTNVMPEPLRREPNAAVIEWLDAQNVETLYLAAIGLAELRFGVAALREGRRRDWLQQSIGQRVLSLFRGRILPFDD
AASRAYASFCARTRAAGNAIAVADGYIAATAEANGSIVATRDVAPFQALGLRIIDPWAVRFAIAGSFGVPKCKTRRAWRR
VLNRTIRLVP
MIPVDTNVMPEPLRREPNAAVIEWLDAQNVETLYLAAIGLAELRFGVAALREGRRRDWLQQSIGQRVLSLFRGRILPFDD
AASRAYASFCARTRAAGNAIAVADGYIAATAEANGSIVATRDVAPFQALGLRIIDPWAVRFAIAGSFGVPKCKTRRAWRR
VLNRTIRLVP
Download Length: 513 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|