Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1169070..1169716 | Replicon | chromosome |
Accession | NZ_HG938371 | ||
Organism | Burkholderia cenocepacia H111 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | I35_RS21680 | Protein ID | WP_006495106.1 |
Coordinates | 1169309..1169716 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | B4EGU8 |
Locus tag | I35_RS21675 | Protein ID | WP_006491146.1 |
Coordinates | 1169070..1169312 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
I35_RS21660 | 1165064..1166470 | + | 1407 | WP_006491136.1 | aspartate ammonia-lyase | - |
I35_RS21665 | 1166548..1168053 | + | 1506 | WP_006495108.1 | amino acid permease | - |
I35_RS21670 | 1168128..1168811 | - | 684 | WP_006495107.1 | phospholipase | - |
I35_RS21675 | 1169070..1169312 | + | 243 | WP_006491146.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
I35_RS21680 | 1169309..1169716 | + | 408 | WP_006495106.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
I35_RS21685 | 1170118..1172493 | + | 2376 | WP_006495105.1 | MCP four helix bundle domain-containing protein | - |
I35_RS21690 | 1172516..1173244 | + | 729 | WP_043204802.1 | chemotaxis protein | - |
I35_RS21695 | 1173241..1173822 | + | 582 | WP_006495103.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14875.95 Da Isoelectric Point: 6.1295
>T285179 WP_006495106.1 NZ_HG938371:1169309-1169716 [Burkholderia cenocepacia H111]
MKFLLDTNAVIAILKGEPAILARLHAWHPADFGIPAIVAHELYYGAYKSQRAAANVARVDALQFEVVSFDTEDAQHAGEI
RAHLIAAGTPIGPYDALIAGQARARHLVLVTHNVREFERVPRLQFEDWLAEPSAD
MKFLLDTNAVIAILKGEPAILARLHAWHPADFGIPAIVAHELYYGAYKSQRAAANVARVDALQFEVVSFDTEDAQHAGEI
RAHLIAAGTPIGPYDALIAGQARARHLVLVTHNVREFERVPRLQFEDWLAEPSAD
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|