Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 797945..798565 | Replicon | chromosome |
| Accession | NZ_HG938371 | ||
| Organism | Burkholderia cenocepacia H111 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | I35_RS20105 | Protein ID | WP_006496016.1 |
| Coordinates | 798248..798565 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | I35_RS20100 | Protein ID | WP_006496017.1 |
| Coordinates | 797945..798244 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I35_RS20075 | 793165..794436 | + | 1272 | WP_006496020.1 | Rieske 2Fe-2S domain-containing protein | - |
| I35_RS20080 | 794452..794928 | + | 477 | WP_006490977.1 | aromatic-ring-hydroxylating dioxygenase subunit beta | - |
| I35_RS20085 | 794964..795290 | + | 327 | WP_006496019.1 | non-heme iron oxygenase ferredoxin subunit | - |
| I35_RS20090 | 795280..796500 | + | 1221 | WP_006496018.1 | FAD-dependent oxidoreductase | - |
| I35_RS20095 | 796610..797896 | + | 1287 | WP_006490986.1 | DUF445 domain-containing protein | - |
| I35_RS20100 | 797945..798244 | - | 300 | WP_006496017.1 | putative addiction module antidote protein | Antitoxin |
| I35_RS20105 | 798248..798565 | - | 318 | WP_006496016.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| I35_RS20110 | 798954..800594 | + | 1641 | WP_006490980.1 | acetolactate synthase large subunit | - |
| I35_RS20115 | 800623..802056 | + | 1434 | WP_006490987.1 | aldehyde dehydrogenase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11817.59 Da Isoelectric Point: 9.5691
>T285178 WP_006496016.1 NZ_HG938371:c798565-798248 [Burkholderia cenocepacia H111]
MPYSPPAFSIRTTDVFDAWFAGLPDRLAKRRIQARIDRLSMGNPGDWKSAGSPVVEMRIDHGPGYRVYYVRRGTIWVILL
CGGDKSTQQADIRAAHAMLAHLDME
MPYSPPAFSIRTTDVFDAWFAGLPDRLAKRRIQARIDRLSMGNPGDWKSAGSPVVEMRIDHGPGYRVYYVRRGTIWVILL
CGGDKSTQQADIRAAHAMLAHLDME
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|