Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 1755243..1755777 | Replicon | chromosome |
Accession | NZ_HG938370 | ||
Organism | Burkholderia cenocepacia H111 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | I35_RS08090 | Protein ID | WP_021033200.1 |
Coordinates | 1755478..1755777 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | I35_RS08085 | Protein ID | WP_021033199.1 |
Coordinates | 1755243..1755488 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
I35_RS08070 | 1751952..1752791 | + | 840 | WP_006496453.1 | Pyoverdine synthetase PvdF, N5-hydroxyornithine formyltransferase | - |
I35_RS08075 | 1752791..1753807 | + | 1017 | WP_006496452.1 | acetyltransferase | - |
I35_RS08080 | 1753965..1755128 | + | 1164 | WP_006496451.1 | amidohydrolase | - |
I35_RS08085 | 1755243..1755488 | + | 246 | WP_021033199.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
I35_RS08090 | 1755478..1755777 | + | 300 | WP_021033200.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
I35_RS08095 | 1755868..1757172 | - | 1305 | WP_006496450.1 | cobyrinate a,c-diamide synthase | - |
I35_RS08100 | 1757175..1757777 | - | 603 | WP_006476035.1 | cob(I)yrinic acid a,c-diamide adenosyltransferase | - |
I35_RS08105 | 1757813..1758190 | - | 378 | WP_006496449.1 | cobalamin biosynthesis protein | - |
I35_RS08110 | 1758187..1758936 | - | 750 | WP_006496448.1 | uroporphyrinogen-III C-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11720.37 Da Isoelectric Point: 6.9677
>T285177 WP_021033200.1 NZ_HG938370:1755478-1755777 [Burkholderia cenocepacia H111]
MAVKGRQLRLTPLAECDLEDIWRYTAEHWSPEQAEHYYRDLIGTMEALARGKKAGRICVVRDGYFRYPAGSHVVFYRETD
ETIDVIRVLHQRMDIERHL
MAVKGRQLRLTPLAECDLEDIWRYTAEHWSPEQAEHYYRDLIGTMEALARGKKAGRICVVRDGYFRYPAGSHVVFYRETD
ETIDVIRVLHQRMDIERHL
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|