Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapC-vagC/VapC-VagC |
Location | 85315..85952 | Replicon | chromosome |
Accession | NZ_HG938370 | ||
Organism | Burkholderia cenocepacia H111 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | I35_RS00365 | Protein ID | WP_043205292.1 |
Coordinates | 85551..85952 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | A0A364GPY9 |
Locus tag | I35_RS00360 | Protein ID | WP_034201144.1 |
Coordinates | 85315..85551 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
I35_RS00340 | 80712..81728 | + | 1017 | WP_006493582.1 | helix-turn-helix domain-containing protein | - |
I35_RS00345 | 81838..82935 | - | 1098 | WP_006496286.1 | ADP-heptose--LPS heptosyltransferase | - |
I35_RS00350 | 82932..84635 | - | 1704 | WP_006496285.1 | thiamine pyrophosphate-binding protein | - |
I35_RS00355 | 84950..85197 | + | 248 | Protein_72 | type II toxin-antitoxin system RelE/ParE family toxin | - |
I35_RS00360 | 85315..85551 | + | 237 | WP_034201144.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
I35_RS00365 | 85551..85952 | + | 402 | WP_043205292.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
I35_RS00370 | 86020..87408 | - | 1389 | WP_006485681.1 | L-serine ammonia-lyase | - |
I35_RS00375 | 87439..88581 | - | 1143 | WP_006496280.1 | alginate lyase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 15071.28 Da Isoelectric Point: 6.2271
>T285176 WP_043205292.1 NZ_HG938370:85551-85952 [Burkholderia cenocepacia H111]
MPRFMLDTNMCIYLMKNQPEQVARRFARCYTGDVVMSAITYAELEYGLTACANPARERRHLAALIEDIPVAPFDAAAAQA
YGPVREATRERKKDHLDKLIAAHAVSLDVVLVTNNERDFVSYPGLRLENWLND
MPRFMLDTNMCIYLMKNQPEQVARRFARCYTGDVVMSAITYAELEYGLTACANPARERRHLAALIEDIPVAPFDAAAAQA
YGPVREATRERKKDHLDKLIAAHAVSLDVVLVTNNERDFVSYPGLRLENWLND
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|