Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 672608..673239 | Replicon | plasmid pHAMBI1141a |
| Accession | NZ_HG938356 | ||
| Organism | Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A068TH98 |
| Locus tag | RG1141_RS25665 | Protein ID | WP_040124626.1 |
| Coordinates | 672608..672994 (-) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A068SYK7 |
| Locus tag | RG1141_RS25670 | Protein ID | WP_040124628.1 |
| Coordinates | 672991..673239 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RG1141_RS25645 | 668366..669181 | - | 816 | WP_051900430.1 | ABC transporter ATP-binding protein | - |
| RG1141_RS25650 | 669238..670263 | - | 1026 | WP_040124624.1 | ABC transporter substrate-binding protein | - |
| RG1141_RS25655 | 670403..671287 | + | 885 | WP_040125757.1 | helix-turn-helix domain-containing protein | - |
| RG1141_RS25660 | 671390..672043 | + | 654 | WP_040124625.1 | HAD hydrolase-like protein | - |
| RG1141_RS32220 | 672441..672590 | - | 150 | WP_157885296.1 | hypothetical protein | - |
| RG1141_RS25665 | 672608..672994 | - | 387 | WP_040124626.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| RG1141_RS25670 | 672991..673239 | - | 249 | WP_040124628.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| RG1141_RS25680 | 673786..674787 | + | 1002 | WP_051900435.1 | LysR family transcriptional regulator | - |
| RG1141_RS25685 | 674784..676274 | + | 1491 | WP_173426778.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| RG1141_RS25690 | 676309..677226 | + | 918 | WP_040124631.1 | ABC transporter permease | - |
| RG1141_RS25695 | 677235..678092 | + | 858 | WP_040124633.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | htpB / htpB | 1..1638739 | 1638739 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 13922.92 Da Isoelectric Point: 5.1702
>T285175 WP_040124626.1 NZ_HG938356:c672994-672608 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MIVDTSALVAILYREPEAARFVKAIHDVELTRISVANYVELSMVVEGQLGPDGMRQAEAFLRRAGIIVEPVTLDHGELAR
QAFPDFGKGRHKAGLNFGDCFAYALAKATGEPLLFKGNDFSQTDVQAA
MIVDTSALVAILYREPEAARFVKAIHDVELTRISVANYVELSMVVEGQLGPDGMRQAEAFLRRAGIIVEPVTLDHGELAR
QAFPDFGKGRHKAGLNFGDCFAYALAKATGEPLLFKGNDFSQTDVQAA
Download Length: 387 bp
Antitoxin
Download Length: 83 a.a. Molecular weight: 9189.45 Da Isoelectric Point: 8.6090
>AT285175 WP_040124628.1 NZ_HG938356:c673239-672991 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MSLSIKDPEAHRLAQAISHATGESMTRVVTEALRERFAKIERRKGRASVEELLAIADRAAANVKRPYVDHADFLYDENGL
PK
MSLSIKDPEAHRLAQAISHATGESMTRVVTEALRERFAKIERRKGRASVEELLAIADRAAANVKRPYVDHADFLYDENGL
PK
Download Length: 249 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A068TH98 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A068SYK7 |