Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09812-MazE |
| Location | 164926..165560 | Replicon | plasmid pHAMBI1141a |
| Accession | NZ_HG938356 | ||
| Organism | Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A068TFV4 |
| Locus tag | RG1141_RS23270 | Protein ID | WP_040124053.1 |
| Coordinates | 164926..165297 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A068THN6 |
| Locus tag | RG1141_RS23275 | Protein ID | WP_040124055.1 |
| Coordinates | 165297..165560 (-) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RG1141_RS23240 | 160381..161958 | + | 1578 | WP_040124046.1 | ATP-binding cassette domain-containing protein | - |
| RG1141_RS23245 | 161965..162522 | - | 558 | WP_040124048.1 | isochorismatase family protein | - |
| RG1141_RS23250 | 162750..162983 | - | 234 | WP_040124049.1 | hypothetical protein | - |
| RG1141_RS23255 | 163134..163916 | - | 783 | WP_040124050.1 | SDR family oxidoreductase | - |
| RG1141_RS23260 | 164007..164426 | - | 420 | WP_040124051.1 | HD domain-containing protein | - |
| RG1141_RS23265 | 164486..164860 | - | 375 | WP_040124052.1 | GFA family protein | - |
| RG1141_RS23270 | 164926..165297 | - | 372 | WP_040124053.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| RG1141_RS23275 | 165297..165560 | - | 264 | WP_040124055.1 | PbsX family transcriptional regulator | Antitoxin |
| RG1141_RS23280 | 165723..166226 | + | 504 | WP_040125675.1 | hypothetical protein | - |
| RG1141_RS23285 | 166250..167626 | - | 1377 | WP_040124057.1 | FAD-binding protein | - |
| RG1141_RS23290 | 167623..169278 | - | 1656 | WP_040124059.1 | thiamine pyrophosphate-requiring protein | - |
| RG1141_RS23295 | 169308..170537 | - | 1230 | WP_040124060.1 | alpha-hydroxy-acid oxidizing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | htpB / htpB | 1..1638739 | 1638739 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13441.43 Da Isoelectric Point: 7.1663
>T285172 WP_040124053.1 NZ_HG938356:c165297-164926 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MIRSNVPRRGDVYWIDPNPVAGREMKNRHRFVVITPIEISRLGVSMTVPITTGGAFIRDVGLAVAISGHDTTGVAVCNQV
RSFDIPARIQQKTAQYIETLDEATMNEIVSRVVSAIDPAPEPA
MIRSNVPRRGDVYWIDPNPVAGREMKNRHRFVVITPIEISRLGVSMTVPITTGGAFIRDVGLAVAISGHDTTGVAVCNQV
RSFDIPARIQQKTAQYIETLDEATMNEIVSRVVSAIDPAPEPA
Download Length: 372 bp
Antitoxin
Download Length: 88 a.a. Molecular weight: 9260.72 Da Isoelectric Point: 5.6492
>AT285172 WP_040124055.1 NZ_HG938356:c165560-165297 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MPVTTKIRRQGGAAVITIPPALLKLMHTEVGDQLTLDVANGELIARPVENGRKRYTLSELLKGSDAMAMLNAAVADAQEG
DPIGHEI
MPVTTKIRRQGGAAVITIPPALLKLMHTEVGDQLTLDVANGELIARPVENGRKRYTLSELLKGSDAMAMLNAAVADAQEG
DPIGHEI
Download Length: 264 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A068TFV4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A068THN6 |