Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 107921..108507 | Replicon | plasmid pHAMBI1141a |
Accession | NZ_HG938356 | ||
Organism | Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A068TFW3 |
Locus tag | RG1141_RS22970 | Protein ID | WP_040123978.1 |
Coordinates | 108253..108507 (-) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A068THI4 |
Locus tag | RG1141_RS22965 | Protein ID | WP_040123976.1 |
Coordinates | 107921..108256 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RG1141_RS22940 | 103074..104024 | - | 951 | WP_080719313.1 | DUF1403 family protein | - |
RG1141_RS22945 | 104257..105786 | + | 1530 | WP_040123968.1 | carboxypeptidase | - |
RG1141_RS22950 | 105908..106630 | + | 723 | WP_040123970.1 | L,D-transpeptidase | - |
RG1141_RS22955 | 106737..107291 | + | 555 | WP_040123972.1 | recombination regulator RecX | - |
RG1141_RS22960 | 107313..107780 | - | 468 | WP_040123974.1 | truncated hemoglobin | - |
RG1141_RS22965 | 107921..108256 | - | 336 | WP_040123976.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
RG1141_RS22970 | 108253..108507 | - | 255 | WP_040123978.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
RG1141_RS22975 | 108595..109800 | - | 1206 | WP_040123979.1 | 3-oxoadipyl-CoA thiolase | - |
RG1141_RS22980 | 109812..110501 | - | 690 | WP_040123981.1 | CoA transferase subunit B | - |
RG1141_RS22985 | 110498..111220 | - | 723 | WP_040123983.1 | 3-oxoacid CoA-transferase subunit A | - |
RG1141_RS22990 | 111412..112167 | + | 756 | WP_040123984.1 | IclR family transcriptional regulator | - |
RG1141_RS22995 | 112253..112528 | + | 276 | WP_051900277.1 | WGR domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | htpB / htpB | 1..1638739 | 1638739 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 9390.85 Da Isoelectric Point: 10.6566
>T285171 WP_040123978.1 NZ_HG938356:c108507-108253 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MKKRHRATLELIYARPASGSIRWVDIEAMFVALGADVTEREGSRIGVVLFGEVRVFHRPHPSPDTDKGAVASIRKWLESH
GVKP
MKKRHRATLELIYARPASGSIRWVDIEAMFVALGADVTEREGSRIGVVLFGEVRVFHRPHPSPDTDKGAVASIRKWLESH
GVKP
Download Length: 255 bp
Antitoxin
Download Length: 112 a.a. Molecular weight: 12192.70 Da Isoelectric Point: 4.5577
>AT285171 WP_040123976.1 NZ_HG938356:c108256-107921 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MRNVIEIEGHKAVVSLDPEIGMFRGEFLGLNGGADFYSDSLDGLMSEGQKSLQTFLEICKEKGIEPFRSFSGRFNVRLDP
RTHEAAVIAATANDQSLNEWLAETIATAARS
MRNVIEIEGHKAVVSLDPEIGMFRGEFLGLNGGADFYSDSLDGLMSEGQKSLQTFLEICKEKGIEPFRSFSGRFNVRLDP
RTHEAAVIAATANDQSLNEWLAETIATAARS
Download Length: 336 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A068TFW3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A068THI4 |