Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 43320..43909 | Replicon | plasmid pHAMBI1141a |
| Accession | NZ_HG938356 | ||
| Organism | Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | RG1141_RS22610 | Protein ID | WP_040123904.1 |
| Coordinates | 43619..43909 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A068TEQ5 |
| Locus tag | RG1141_RS22605 | Protein ID | WP_040125653.1 |
| Coordinates | 43320..43616 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RG1141_RS22585 | 38439..39494 | - | 1056 | WP_040123900.1 | ABC transporter ATP-binding protein | - |
| RG1141_RS22590 | 39494..40351 | - | 858 | WP_040123901.1 | carbohydrate ABC transporter permease | - |
| RG1141_RS22595 | 40354..41655 | - | 1302 | WP_040123902.1 | sugar ABC transporter permease | - |
| RG1141_RS22600 | 41785..43131 | - | 1347 | WP_040123903.1 | extracellular solute-binding protein | - |
| RG1141_RS22605 | 43320..43616 | - | 297 | WP_040125653.1 | putative addiction module antidote protein | Antitoxin |
| RG1141_RS22610 | 43619..43909 | - | 291 | WP_040123904.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| RG1141_RS22615 | 43951..45012 | - | 1062 | WP_040123905.1 | molybdenum ABC transporter ATP-binding protein | - |
| RG1141_RS22620 | 45009..45710 | - | 702 | WP_040123906.1 | molybdate ABC transporter permease subunit | - |
| RG1141_RS22625 | 45927..46154 | - | 228 | WP_157885274.1 | hypothetical protein | - |
| RG1141_RS22630 | 46241..46471 | - | 231 | WP_040123908.1 | hypothetical protein | - |
| RG1141_RS22635 | 46768..47562 | - | 795 | WP_040123909.1 | molybdate ABC transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | htpB / htpB | 1..1638739 | 1638739 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10828.60 Da Isoelectric Point: 10.1771
>T285169 WP_040123904.1 NZ_HG938356:c43909-43619 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MIEVRKTAAFSKWFGELRDHNARMRIVTRIRRMEIGNLGDVKPVGEGISEARIAYGPGYRLYFIQQGQEIIILLCGGDKS
TQSKDIASAKQMAKEI
MIEVRKTAAFSKWFGELRDHNARMRIVTRIRRMEIGNLGDVKPVGEGISEARIAYGPGYRLYFIQQGQEIIILLCGGDKS
TQSKDIASAKQMAKEI
Download Length: 291 bp
Antitoxin
Download Length: 99 a.a. Molecular weight: 10495.04 Da Isoelectric Point: 4.6310
>AT285169 WP_040125653.1 NZ_HG938356:c43616-43320 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
VPIETTKWDVQDYLKTPEERVAYLEAAFEDGDPKLISIALGDVARSMGMTTVAKEAGITREALYKALSDKGDPKLSTLLG
VLKALGLRVTVTSANEAA
VPIETTKWDVQDYLKTPEERVAYLEAAFEDGDPKLISIALGDVARSMGMTTVAKEAGITREALYKALSDKGDPKLSTLLG
VLKALGLRVTVTSANEAA
Download Length: 297 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|