Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 4495115..4495698 | Replicon | chromosome |
| Accession | NZ_HG938355 | ||
| Organism | Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | A0A068TF81 |
| Locus tag | RG1141_RS21855 | Protein ID | WP_038548341.1 |
| Coordinates | 4495402..4495698 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | A0A068TGX6 |
| Locus tag | RG1141_RS21850 | Protein ID | WP_038548338.1 |
| Coordinates | 4495115..4495402 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RG1141_RS21825 | 4491639..4491869 | - | 231 | WP_038548326.1 | hypothetical protein | - |
| RG1141_RS21830 | 4492010..4492288 | - | 279 | WP_157885208.1 | hypothetical protein | - |
| RG1141_RS21835 | 4492301..4492564 | - | 264 | WP_038548331.1 | hypothetical protein | - |
| RG1141_RS21840 | 4492868..4494475 | + | 1608 | WP_038548333.1 | exodeoxyribonuclease VII large subunit | - |
| RG1141_RS21845 | 4494475..4495068 | + | 594 | WP_038548336.1 | NAD(P)H-dependent oxidoreductase | - |
| RG1141_RS21850 | 4495115..4495402 | - | 288 | WP_038548338.1 | putative addiction module antidote protein | Antitoxin |
| RG1141_RS21855 | 4495402..4495698 | - | 297 | WP_038548341.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| RG1141_RS21860 | 4495749..4497002 | - | 1254 | WP_038548344.1 | aminopeptidase | - |
| RG1141_RS21865 | 4497082..4497891 | + | 810 | WP_157885209.1 | hypothetical protein | - |
| RG1141_RS21870 | 4497921..4498808 | - | 888 | WP_038549963.1 | MBL fold metallo-hydrolase | - |
| RG1141_RS21875 | 4498817..4499290 | - | 474 | WP_038548349.1 | Cys-tRNA(Pro) deacylase | - |
| RG1141_RS21880 | 4499307..4499660 | - | 354 | WP_038548352.1 | ArsC family reductase | - |
| RG1141_RS32515 | 4499834..4499998 | + | 165 | WP_173426764.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11079.75 Da Isoelectric Point: 10.0489
>T285168 WP_038548341.1 NZ_HG938355:c4495698-4495402 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
VFELKQTETFLKWRTRLKDERARALIASRLDRLAFGHAGDVAPVGEGVSELRIHHGPGYRVYFQQRGDILIVLLCGGDKS
SQAKDIKAAKRLAMEWSE
VFELKQTETFLKWRTRLKDERARALIASRLDRLAFGHAGDVAPVGEGVSELRIHHGPGYRVYFQQRGDILIVLLCGGDKS
SQAKDIKAAKRLAMEWSE
Download Length: 297 bp
Antitoxin
Download Length: 96 a.a. Molecular weight: 10109.55 Da Isoelectric Point: 5.0495
>AT285168 WP_038548338.1 NZ_HG938355:c4495402-4495115 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MAEKLTVYDPAEDLGSDQAIAAFMAEAFETEDAAYIAHALGVVARAKGMMQIAKDTGLSREQLYRSFSATGNPTLKTTIA
VMKSLGIELTAKAHS
MAEKLTVYDPAEDLGSDQAIAAFMAEAFETEDAAYIAHALGVVARAKGMMQIAKDTGLSREQLYRSFSATGNPTLKTTIA
VMKSLGIELTAKAHS
Download Length: 288 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A068TF81 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A068TGX6 |