Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-RHH |
| Location | 3676464..3676999 | Replicon | chromosome |
| Accession | NZ_HG938355 | ||
| Organism | Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A068TC26 |
| Locus tag | RG1141_RS18055 | Protein ID | WP_038546593.1 |
| Coordinates | 3676464..3676754 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A068TCY9 |
| Locus tag | RG1141_RS18060 | Protein ID | WP_038546596.1 |
| Coordinates | 3676751..3676999 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RG1141_RS18030 | 3672187..3672609 | + | 423 | WP_038546579.1 | hypothetical protein | - |
| RG1141_RS18035 | 3672617..3673258 | - | 642 | WP_038546581.1 | LysE family translocator | - |
| RG1141_RS18040 | 3673412..3673876 | + | 465 | WP_038546583.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| RG1141_RS18045 | 3673899..3675074 | + | 1176 | WP_038546585.1 | multidrug effflux MFS transporter | - |
| RG1141_RS18050 | 3675128..3676351 | - | 1224 | WP_038546590.1 | argininosuccinate synthase | - |
| RG1141_RS18055 | 3676464..3676754 | - | 291 | WP_038546593.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| RG1141_RS18060 | 3676751..3676999 | - | 249 | WP_038546596.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| RG1141_RS18065 | 3677116..3677973 | + | 858 | WP_038546599.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| RG1141_RS18070 | 3678048..3678689 | + | 642 | WP_038546602.1 | LysE family translocator | - |
| RG1141_RS18075 | 3678712..3679950 | - | 1239 | WP_038546605.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| RG1141_RS18080 | 3680172..3680738 | - | 567 | WP_038549779.1 | hypothetical protein | - |
| RG1141_RS18085 | 3681068..3681631 | + | 564 | WP_038546608.1 | sigma-70 family RNA polymerase sigma factor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11143.68 Da Isoelectric Point: 8.8174
>T285166 WP_038546593.1 NZ_HG938355:c3676754-3676464 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MKTLIFAPKATADIDHIYDYTDETWGYNQAEEYTFGIRDFCRALSLGERSGRKIDQIKRGYRALAYGSHFIVYRETPTTI
SIIRVLHQRMNIGGHL
MKTLIFAPKATADIDHIYDYTDETWGYNQAEEYTFGIRDFCRALSLGERSGRKIDQIKRGYRALAYGSHFIVYRETPTTI
SIIRVLHQRMNIGGHL
Download Length: 291 bp
Antitoxin
Download Length: 83 a.a. Molecular weight: 9077.03 Da Isoelectric Point: 4.1155
>AT285166 WP_038546596.1 NZ_HG938355:c3676999-3676751 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MGKMTSITVDEELTEFIDRQVSGGNYSSPSEVVEAALRLLRDSEGGIEAIRAAIEEGEASGEPQPFDFDEFIEKKRALRA
ER
MGKMTSITVDEELTEFIDRQVSGGNYSSPSEVVEAALRLLRDSEGGIEAIRAAIEEGEASGEPQPFDFDEFIEKKRALRA
ER
Download Length: 249 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A068TC26 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A068TCY9 |