Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 3676464..3676999 Replicon chromosome
Accession NZ_HG938355
Organism Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141

Toxin (Protein)


Gene name parE Uniprot ID A0A068TC26
Locus tag RG1141_RS18055 Protein ID WP_038546593.1
Coordinates 3676464..3676754 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A068TCY9
Locus tag RG1141_RS18060 Protein ID WP_038546596.1
Coordinates 3676751..3676999 (-) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RG1141_RS18030 3672187..3672609 + 423 WP_038546579.1 hypothetical protein -
RG1141_RS18035 3672617..3673258 - 642 WP_038546581.1 LysE family translocator -
RG1141_RS18040 3673412..3673876 + 465 WP_038546583.1 MarR family winged helix-turn-helix transcriptional regulator -
RG1141_RS18045 3673899..3675074 + 1176 WP_038546585.1 multidrug effflux MFS transporter -
RG1141_RS18050 3675128..3676351 - 1224 WP_038546590.1 argininosuccinate synthase -
RG1141_RS18055 3676464..3676754 - 291 WP_038546593.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
RG1141_RS18060 3676751..3676999 - 249 WP_038546596.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
RG1141_RS18065 3677116..3677973 + 858 WP_038546599.1 SDR family NAD(P)-dependent oxidoreductase -
RG1141_RS18070 3678048..3678689 + 642 WP_038546602.1 LysE family translocator -
RG1141_RS18075 3678712..3679950 - 1239 WP_038546605.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
RG1141_RS18080 3680172..3680738 - 567 WP_038549779.1 hypothetical protein -
RG1141_RS18085 3681068..3681631 + 564 WP_038546608.1 sigma-70 family RNA polymerase sigma factor -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin

Antitoxin ParD

(1-77)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11143.68 Da        Isoelectric Point: 8.8174

>T285166 WP_038546593.1 NZ_HG938355:c3676754-3676464 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MKTLIFAPKATADIDHIYDYTDETWGYNQAEEYTFGIRDFCRALSLGERSGRKIDQIKRGYRALAYGSHFIVYRETPTTI
SIIRVLHQRMNIGGHL

Download         Length: 291 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9077.03 Da        Isoelectric Point: 4.1155

>AT285166 WP_038546596.1 NZ_HG938355:c3676999-3676751 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MGKMTSITVDEELTEFIDRQVSGGNYSSPSEVVEAALRLLRDSEGGIEAIRAAIEEGEASGEPQPFDFDEFIEKKRALRA
ER

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A068TC26

Antitoxin

Source ID Structure
AlphaFold DB A0A068TCY9

References