Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 2517931..2518423 | Replicon | chromosome |
Accession | NZ_HG938355 | ||
Organism | Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | RG1141_RS12665 | Protein ID | WP_038549463.1 |
Coordinates | 2518154..2518423 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | RG1141_RS12660 | Protein ID | WP_197569336.1 |
Coordinates | 2517931..2518173 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RG1141_RS12640 | 2513105..2514058 | + | 954 | WP_038549459.1 | metallophosphoesterase | - |
RG1141_RS12645 | 2514157..2514636 | + | 480 | WP_038544285.1 | RNA polymerase sigma factor | - |
RG1141_RS12650 | 2514639..2515484 | + | 846 | WP_038544288.1 | anti-sigma factor | - |
RG1141_RS32050 | 2515596..2515733 | + | 138 | WP_157885153.1 | hypothetical protein | - |
RG1141_RS12655 | 2515883..2517604 | - | 1722 | WP_038544291.1 | 2-isopropylmalate synthase | - |
RG1141_RS12660 | 2517931..2518173 | - | 243 | WP_197569336.1 | CopG family transcriptional regulator | Antitoxin |
RG1141_RS12665 | 2518154..2518423 | - | 270 | WP_038549463.1 | BrnT family toxin | Toxin |
RG1141_RS12670 | 2518462..2519640 | - | 1179 | WP_038544293.1 | benzoate/H(+) symporter BenE family transporter | - |
RG1141_RS12675 | 2519928..2520872 | + | 945 | WP_051899774.1 | sensor domain-containing diguanylate cyclase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10587.80 Da Isoelectric Point: 8.4937
>T285164 WP_038549463.1 NZ_HG938355:c2518423-2518154 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MKFEFDPDKSATNKDKHGIDFVEAQALWADERRTVAPVQSDTESRYILTGKIAEKHWTAVYTWRGDWLRIISVRRARDKE
KQTYEDNNR
MKFEFDPDKSATNKDKHGIDFVEAQALWADERRTVAPVQSDTESRYILTGKIAEKHWTAVYTWRGDWLRIISVRRARDKE
KQTYEDNNR
Download Length: 270 bp
Antitoxin
Download Length: 81 a.a. Molecular weight: 9335.57 Da Isoelectric Point: 6.3654
>AT285164 WP_197569336.1 NZ_HG938355:c2518173-2517931 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MKTITAEEFDKKFDDGEDISEYVDWSKATRPGLEPKRVNIDFPTWVVNGLDQEARRLGVTRQSLVKLWIAERLEARRQGK
MKTITAEEFDKKFDDGEDISEYVDWSKATRPGLEPKRVNIDFPTWVVNGLDQEARRLGVTRQSLVKLWIAERLEARRQGK
Download Length: 243 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|