Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 2491378..2491916 | Replicon | chromosome |
Accession | NZ_HG938355 | ||
Organism | Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A068T9Y4 |
Locus tag | RG1141_RS12525 | Protein ID | WP_038544248.1 |
Coordinates | 2491638..2491916 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A068T8Y4 |
Locus tag | RG1141_RS12520 | Protein ID | WP_038544246.1 |
Coordinates | 2491378..2491638 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RG1141_RS12505 | 2487447..2488025 | - | 579 | WP_038544239.1 | ubiquinol-cytochrome c reductase iron-sulfur subunit | - |
RG1141_RS32045 | 2488417..2489355 | + | 939 | WP_038544243.1 | endonuclease/exonuclease/phosphatase family protein | - |
RG1141_RS12515 | 2489361..2491223 | - | 1863 | WP_038544244.1 | ABC transporter ATP-binding protein/permease | - |
RG1141_RS12520 | 2491378..2491638 | + | 261 | WP_038544246.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
RG1141_RS12525 | 2491638..2491916 | + | 279 | WP_038544248.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
RG1141_RS12530 | 2491976..2493832 | - | 1857 | WP_038544249.1 | ABC transporter ATP-binding protein/permease | - |
RG1141_RS12535 | 2494220..2494705 | + | 486 | WP_038544251.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
RG1141_RS12540 | 2494769..2495251 | + | 483 | WP_162182336.1 | redox-sensitive transcriptional activator SoxR | - |
RG1141_RS12545 | 2495327..2495629 | + | 303 | WP_038544253.1 | putative addiction module antidote protein | - |
RG1141_RS12550 | 2495788..2496216 | + | 429 | WP_038544255.1 | hypothetical protein | - |
RG1141_RS12555 | 2496226..2496483 | - | 258 | WP_037076370.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10734.44 Da Isoelectric Point: 10.2108
>T285163 WP_038544248.1 NZ_HG938355:2491638-2491916 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MELKWSSKAVSDLNRLHDFLAAVNAPAAARTAQNLAAAPKKLIQHPRLGERLDEFAPREIRRLLIGDYELRYEIQGEMIF
LLRIWHTRENRI
MELKWSSKAVSDLNRLHDFLAAVNAPAAARTAQNLAAAPKKLIQHPRLGERLDEFAPREIRRLLIGDYELRYEIQGEMIF
LLRIWHTRENRI
Download Length: 279 bp
Antitoxin
Download Length: 87 a.a. Molecular weight: 9836.22 Da Isoelectric Point: 4.5702
>AT285163 WP_038544246.1 NZ_HG938355:2491378-2491638 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
METRVLTTHVPVQLAEKVDELATRLERSRGWIVKQALASWIELEEERRRLTLEAMADVDAGNVVDQEEVEKWVSSLGTDK
PLPRPL
METRVLTTHVPVQLAEKVDELATRLERSRGWIVKQALASWIELEEERRRLTLEAMADVDAGNVVDQEEVEKWVSSLGTDK
PLPRPL
Download Length: 261 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A068T9Y4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A068T8Y4 |