Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 863131..863726 | Replicon | chromosome |
Accession | NZ_HG938355 | ||
Organism | Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A068T7C2 |
Locus tag | RG1141_RS04475 | Protein ID | WP_038541376.1 |
Coordinates | 863131..863496 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A068SLL3 |
Locus tag | RG1141_RS04480 | Protein ID | WP_038541378.1 |
Coordinates | 863493..863726 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RG1141_RS04450 | 858175..859401 | - | 1227 | WP_051899673.1 | efflux RND transporter periplasmic adaptor subunit | - |
RG1141_RS04455 | 859603..859806 | - | 204 | WP_038541367.1 | hypothetical protein | - |
RG1141_RS04460 | 859907..860275 | - | 369 | WP_038541369.1 | hypothetical protein | - |
RG1141_RS04465 | 860401..861204 | - | 804 | WP_038541371.1 | SDR family oxidoreductase | - |
RG1141_RS04470 | 861463..863124 | + | 1662 | WP_038541374.1 | electron transfer flavoprotein-ubiquinone oxidoreductase | - |
RG1141_RS04475 | 863131..863496 | - | 366 | WP_038541376.1 | PIN domain-containing protein | Toxin |
RG1141_RS04480 | 863493..863726 | - | 234 | WP_038541378.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
RG1141_RS04485 | 863919..864530 | + | 612 | WP_038541380.1 | L,D-transpeptidase | - |
RG1141_RS04490 | 864606..865622 | - | 1017 | WP_038541382.1 | zinc-binding alcohol dehydrogenase family protein | - |
RG1141_RS04495 | 865746..866141 | + | 396 | WP_038541384.1 | helix-turn-helix transcriptional regulator | - |
RG1141_RS04500 | 866336..867577 | - | 1242 | WP_038541386.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13539.92 Da Isoelectric Point: 7.4683
>T285160 WP_038541376.1 NZ_HG938355:c863496-863131 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
VILLDTSIWIDHLRKREEAVEFLLKRKQVLVHPFVIGEVALGPMPRYDLVLQSLSELPQALVASDPEVLLLIRQHSLMGS
GIGYVDAHLLASTRLHEGTRLLTRDKRLARIATALGIGYEP
VILLDTSIWIDHLRKREEAVEFLLKRKQVLVHPFVIGEVALGPMPRYDLVLQSLSELPQALVASDPEVLLLIRQHSLMGS
GIGYVDAHLLASTRLHEGTRLLTRDKRLARIATALGIGYEP
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A068T7C2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A068SLL3 |