Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 735148..735728 Replicon chromosome
Accession NZ_HG938355
Organism Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag RG1141_RS03780 Protein ID WP_038541017.1
Coordinates 735148..735402 (+) Length 85 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A068T6Z6
Locus tag RG1141_RS03785 Protein ID WP_038541020.1
Coordinates 735399..735728 (+) Length 110 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RG1141_RS03750 730439..731281 + 843 WP_038540999.1 metallophosphoesterase -
RG1141_RS03755 731284..731928 - 645 WP_038541003.1 ThuA domain-containing protein -
RG1141_RS03760 732025..732714 - 690 WP_038541006.1 YafY family transcriptional regulator -
RG1141_RS03765 732850..733482 + 633 WP_038541008.1 LysE family translocator -
RG1141_RS03770 733664..734104 + 441 WP_038541011.1 cytochrome c -
RG1141_RS03775 734189..735103 + 915 WP_157885084.1 cytochrome c -
RG1141_RS03780 735148..735402 + 255 WP_038541017.1 type II toxin-antitoxin system HicA family toxin Toxin
RG1141_RS03785 735399..735728 + 330 WP_038541020.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
RG1141_RS03790 735745..736242 - 498 WP_038541023.1 GNAT family N-acetyltransferase -
RG1141_RS03795 736420..737394 - 975 WP_038548903.1 prolyl aminopeptidase -
RG1141_RS03800 737527..737820 + 294 WP_038541026.1 hypothetical protein -
RG1141_RS03805 737807..738169 + 363 WP_038541029.1 hypothetical protein -
RG1141_RS03810 738189..738602 - 414 WP_038541031.1 helix-turn-helix domain-containing protein -
RG1141_RS03815 738756..739316 - 561 WP_038541034.1 hypothetical protein -
RG1141_RS03820 739444..739716 + 273 WP_038541037.1 Ni(II)/Co(II)-sensing transcriptional repressor DmeR -
RG1141_RS03825 739737..740720 + 984 WP_038541041.1 CDF family Co(II)/Ni(II) efflux transporter DmeF -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(23-82)

Antitoxin

Uncharacterised protein family HicB

(54-104)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9576.02 Da        Isoelectric Point: 8.0701

>T285158 WP_038541017.1 NZ_HG938355:735148-735402 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MNSKQRKTLVAIFQDPVSPSIDWSDVENLLIAVGCHLLEGSGSRVRFEKDGLVVFFHRPHPDKEAKRYQIKDARLFLSQL
GIEP

Download         Length: 255 bp

Antitoxin


Download         Length: 110 a.a.        Molecular weight: 11919.40 Da        Isoelectric Point: 4.9230

>AT285158 WP_038541020.1 NZ_HG938355:735399-735728 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MNVLEYKGYSARIEFDAEDEIFVGHIAGIADVVGFHADSVVDLKTAFHEAVDDYLETCERLGRSPHKPYSGRVMFRIDPD
VHARAAKAAELAGKSLNEWAGEILAKAAG

Download         Length: 330 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A068T6Z6

References