Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_26 |
Location | 670242..670844 | Replicon | chromosome |
Accession | NZ_HG938355 | ||
Organism | Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | RG1141_RS03380 | Protein ID | WP_038548874.1 |
Coordinates | 670242..670487 (+) | Length | 82 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A068T6T1 |
Locus tag | RG1141_RS03385 | Protein ID | WP_038540814.1 |
Coordinates | 670491..670844 (+) | Length | 118 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RG1141_RS03360 | 666470..667828 | + | 1359 | WP_038540805.1 | virulence factor family protein | - |
RG1141_RS31250 | 667955..668170 | + | 216 | WP_080719124.1 | ribbon-helix-helix protein, CopG family | - |
RG1141_RS03370 | 668164..668540 | + | 377 | Protein_673 | type II toxin-antitoxin system VapC family toxin | - |
RG1141_RS03375 | 668541..670190 | - | 1650 | WP_038540811.1 | choline dehydrogenase | - |
RG1141_RS03380 | 670242..670487 | + | 246 | WP_038548874.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
RG1141_RS03385 | 670491..670844 | + | 354 | WP_038540814.1 | helix-turn-helix transcriptional regulator | Antitoxin |
RG1141_RS03390 | 670853..672316 | - | 1464 | WP_038540817.1 | betaine-aldehyde dehydrogenase | - |
RG1141_RS03395 | 672318..673841 | - | 1524 | WP_038540820.1 | choline-sulfatase | - |
RG1141_RS03405 | 674374..674921 | + | 548 | Protein_679 | HdeD family acid-resistance protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 82 a.a. Molecular weight: 9049.61 Da Isoelectric Point: 10.9252
>T285157 WP_038548874.1 NZ_HG938355:670242-670487 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MKAVLYSKVAQKSLSRMQPKRQAAIRAKVDAFARGDRVDLKRLEGSALVRIRVGNDRIIIDEETNLVVVIDVGPRGGIYK
E
MKAVLYSKVAQKSLSRMQPKRQAAIRAKVDAFARGDRVDLKRLEGSALVRIRVGNDRIIIDEETNLVVVIDVGPRGGIYK
E
Download Length: 246 bp
Antitoxin
Download Length: 118 a.a. Molecular weight: 13115.97 Da Isoelectric Point: 4.1723
>AT285157 WP_038540814.1 NZ_HG938355:670491-670844 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MGVFDKTVIDGKSYVLVPEDDFEDMMDTIKANEILARIAAGEETWPAELVYELLETESRIRTFRNYRKMTVSELAEAAGI
SQPYLSEIETGKKTGSVDVLKRIAAVLKVDLDDLVLD
MGVFDKTVIDGKSYVLVPEDDFEDMMDTIKANEILARIAAGEETWPAELVYELLETESRIRTFRNYRKMTVSELAEAAGI
SQPYLSEIETGKKTGSVDVLKRIAAVLKVDLDDLVLD
Download Length: 354 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|