Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-RHH |
| Location | 658927..659461 | Replicon | chromosome |
| Accession | NZ_HG938355 | ||
| Organism | Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A068T4K5 |
| Locus tag | RG1141_RS03325 | Protein ID | WP_038540785.1 |
| Coordinates | 659162..659461 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A068T3J2 |
| Locus tag | RG1141_RS03320 | Protein ID | WP_038540781.1 |
| Coordinates | 658927..659172 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RG1141_RS03300 | 654784..656283 | - | 1500 | WP_038540768.1 | sulfate adenylyltransferase subunit CysN | - |
| RG1141_RS03305 | 656285..657238 | - | 954 | WP_038540771.1 | sulfate adenylyltransferase subunit CysD | - |
| RG1141_RS03310 | 657280..658050 | - | 771 | WP_038540775.1 | phosphoadenylyl-sulfate reductase | - |
| RG1141_RS03315 | 658411..658866 | + | 456 | WP_038540778.1 | Rrf2 family transcriptional regulator | - |
| RG1141_RS03320 | 658927..659172 | + | 246 | WP_038540781.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| RG1141_RS03325 | 659162..659461 | + | 300 | WP_038540785.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| RG1141_RS03330 | 659746..660747 | + | 1002 | WP_173426768.1 | sulfate ABC transporter substrate-binding protein | - |
| RG1141_RS03335 | 660761..661618 | + | 858 | WP_038540790.1 | sulfate ABC transporter permease subunit CysT | - |
| RG1141_RS03340 | 661611..662489 | + | 879 | WP_038540793.1 | sulfate ABC transporter permease subunit CysW | - |
| RG1141_RS03345 | 662505..663542 | + | 1038 | WP_038540795.1 | sulfate/molybdate ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11535.05 Da Isoelectric Point: 6.0798
>T285156 WP_038540785.1 NZ_HG938355:659162-659461 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MAAKGRDYKLSPLAEEDLEDIWGYTVETWSWEQAERYHDELISTLEGLAAGRKLGRPVDIRQGYFKYSVGAHCVFYRFSE
SAIDIIRILHQKMDVSRHL
MAAKGRDYKLSPLAEEDLEDIWGYTVETWSWEQAERYHDELISTLEGLAAGRKLGRPVDIRQGYFKYSVGAHCVFYRFSE
SAIDIIRILHQKMDVSRHL
Download Length: 300 bp
Antitoxin
Download Length: 82 a.a. Molecular weight: 8937.99 Da Isoelectric Point: 7.3199
>AT285156 WP_038540781.1 NZ_HG938355:658927-659172 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MARNTSISLGDHFASFIDTQVESGRYGSASDVVRAGLRLLEEHEARVKALQDALIAGEESGPPQPFDNQAFLKRMRARHG
R
MARNTSISLGDHFASFIDTQVESGRYGSASDVVRAGLRLLEEHEARVKALQDALIAGEESGPPQPFDNQAFLKRMRARHG
R
Download Length: 246 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A068T4K5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A068T3J2 |