Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | BrnTA/BrnT-BrnA |
Location | 583949..584508 | Replicon | chromosome |
Accession | NZ_HG938355 | ||
Organism | Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 |
Toxin (Protein)
Gene name | brnT | Uniprot ID | - |
Locus tag | RG1141_RS02895 | Protein ID | WP_038540580.1 |
Coordinates | 584260..584508 (-) | Length | 83 a.a. |
Antitoxin (Protein)
Gene name | brnA | Uniprot ID | A0A068T6L4 |
Locus tag | RG1141_RS02890 | Protein ID | WP_038540576.1 |
Coordinates | 583949..584263 (-) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RG1141_RS02870 | 579421..580647 | + | 1227 | WP_038548828.1 | AGE family epimerase/isomerase | - |
RG1141_RS02875 | 580652..581719 | + | 1068 | WP_038540567.1 | sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | - |
RG1141_RS02880 | 581741..582916 | + | 1176 | WP_038540570.1 | mannonate dehydratase | - |
RG1141_RS02885 | 582941..583942 | + | 1002 | WP_038540574.1 | Gfo/Idh/MocA family oxidoreductase | - |
RG1141_RS02890 | 583949..584263 | - | 315 | WP_038540576.1 | BrnA antitoxin family protein | Antitoxin |
RG1141_RS02895 | 584260..584508 | - | 249 | WP_038540580.1 | BrnT family toxin | Toxin |
RG1141_RS02900 | 584598..585698 | - | 1101 | WP_038540584.1 | 3,4-dihydroxy-2-butanone-4-phosphate synthase | - |
RG1141_RS02905 | 585711..586823 | - | 1113 | WP_038540587.1 | chorismate synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 83 a.a. Molecular weight: 9286.87 Da Isoelectric Point: 10.2014
>T285155 WP_038540580.1 NZ_HG938355:c584508-584260 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MKIIWDETKRIVNLEKHGLDFADLYFEFFATAVTTPARKARSKAVGRLKDGTIVVIFLTLGSEAISVISMRPARKDERSM
VE
MKIIWDETKRIVNLEKHGLDFADLYFEFFATAVTTPARKARSKAVGRLKDGTIVVIFLTLGSEAISVISMRPARKDERSM
VE
Download Length: 249 bp
Antitoxin
Download Length: 105 a.a. Molecular weight: 11829.68 Da Isoelectric Point: 9.8648
>AT285155 WP_038540576.1 NZ_HG938355:c584263-583949 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MNIKHEKQKEFRPGRGYTKEDWDAVDSPPLTAEEMASMRPFREVFPEMAAKMEQAIAARGRPKVEAPKVAVTLRLDPDVL
EKYKASGKDWRAKMAEELRKAAGL
MNIKHEKQKEFRPGRGYTKEDWDAVDSPPLTAEEMASMRPFREVFPEMAAKMEQAIAARGRPKVEAPKVAVTLRLDPDVL
EKYKASGKDWRAKMAEELRKAAGL
Download Length: 315 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|