Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PemK-MazE
Location 535763..536298 Replicon chromosome
Accession NZ_HG938355
Organism Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141

Toxin (Protein)


Gene name mazF Uniprot ID A0A068T365
Locus tag RG1141_RS02675 Protein ID WP_038548801.1
Coordinates 535978..536298 (+) Length 107 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag RG1141_RS31225 Protein ID WP_080719117.1
Coordinates 535763..535978 (+) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RG1141_RS02640 531040..531654 - 615 WP_038540463.1 hypothetical protein -
RG1141_RS02650 532154..533398 + 1245 WP_038540470.1 aromatic ring-hydroxylating dioxygenase subunit alpha -
RG1141_RS02655 533507..533926 + 420 WP_038540473.1 BA14K family protein -
RG1141_RS02660 534115..534564 + 450 WP_038540477.1 BA14K family protein -
RG1141_RS02665 534633..535628 - 996 WP_038548798.1 transporter -
RG1141_RS31225 535763..535978 + 216 WP_080719117.1 antitoxin MazE family protein Antitoxin
RG1141_RS02675 535978..536298 + 321 WP_038548801.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
RG1141_RS02680 536406..538199 + 1794 WP_038540482.1 acyl-CoA dehydrogenase -
RG1141_RS02685 538211..538969 + 759 WP_038540484.1 crotonase/enoyl-CoA hydratase family protein -
RG1141_RS32560 539052..539453 + 402 WP_197569342.1 hypothetical protein -
RG1141_RS02695 539481..540725 - 1245 WP_038540490.1 class I SAM-dependent RNA methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(2-103)

Antitoxin

Antitoxin MazE-like

(6-69)


Sequences

Toxin        


Download         Length: 107 a.a.        Molecular weight: 11566.63 Da        Isoelectric Point: 10.2947

>T285154 WP_038548801.1 NZ_HG938355:535978-536298 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MRRGDLVTVALAGDFGKPRPALVIQSDLFDTDTLTVLLLSSTIVNTPLIRIMVQPTPRNALNSPSQIMIDKAMTLKREKI
GRVFGSIEDDILVAVNRSLAVFFGLA

Download         Length: 321 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 8004.03 Da        Isoelectric Point: 6.9799

>AT285154 WP_080719117.1 NZ_HG938355:535763-535978 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MASSVNERVRKRRENLRASGLRPVQIWVPDTRRPGFAEECHRQSRLVAAADAADPDLMKFLDDALADLGEQ

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A068T365

Antitoxin

Source ID Structure

References