Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-MazE |
Location | 535763..536298 | Replicon | chromosome |
Accession | NZ_HG938355 | ||
Organism | Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A068T365 |
Locus tag | RG1141_RS02675 | Protein ID | WP_038548801.1 |
Coordinates | 535978..536298 (+) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | RG1141_RS31225 | Protein ID | WP_080719117.1 |
Coordinates | 535763..535978 (+) | Length | 72 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RG1141_RS02640 | 531040..531654 | - | 615 | WP_038540463.1 | hypothetical protein | - |
RG1141_RS02650 | 532154..533398 | + | 1245 | WP_038540470.1 | aromatic ring-hydroxylating dioxygenase subunit alpha | - |
RG1141_RS02655 | 533507..533926 | + | 420 | WP_038540473.1 | BA14K family protein | - |
RG1141_RS02660 | 534115..534564 | + | 450 | WP_038540477.1 | BA14K family protein | - |
RG1141_RS02665 | 534633..535628 | - | 996 | WP_038548798.1 | transporter | - |
RG1141_RS31225 | 535763..535978 | + | 216 | WP_080719117.1 | antitoxin MazE family protein | Antitoxin |
RG1141_RS02675 | 535978..536298 | + | 321 | WP_038548801.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
RG1141_RS02680 | 536406..538199 | + | 1794 | WP_038540482.1 | acyl-CoA dehydrogenase | - |
RG1141_RS02685 | 538211..538969 | + | 759 | WP_038540484.1 | crotonase/enoyl-CoA hydratase family protein | - |
RG1141_RS32560 | 539052..539453 | + | 402 | WP_197569342.1 | hypothetical protein | - |
RG1141_RS02695 | 539481..540725 | - | 1245 | WP_038540490.1 | class I SAM-dependent RNA methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 11566.63 Da Isoelectric Point: 10.2947
>T285154 WP_038548801.1 NZ_HG938355:535978-536298 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MRRGDLVTVALAGDFGKPRPALVIQSDLFDTDTLTVLLLSSTIVNTPLIRIMVQPTPRNALNSPSQIMIDKAMTLKREKI
GRVFGSIEDDILVAVNRSLAVFFGLA
MRRGDLVTVALAGDFGKPRPALVIQSDLFDTDTLTVLLLSSTIVNTPLIRIMVQPTPRNALNSPSQIMIDKAMTLKREKI
GRVFGSIEDDILVAVNRSLAVFFGLA
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|