Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/CC2985(antitoxin) |
| Location | 1558278..1558825 | Replicon | plasmid pHAMBI540a |
| Accession | NZ_HG938354 | ||
| Organism | Neorhizobium galegae bv. orientalis str. HAMBI 540 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A068T425 |
| Locus tag | RG540_RS29905 | Protein ID | WP_041365974.1 |
| Coordinates | 1558278..1558571 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A068T289 |
| Locus tag | RG540_RS29910 | Protein ID | WP_041365976.1 |
| Coordinates | 1558571..1558825 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RG540_RS29885 | 1554341..1555429 | + | 1089 | WP_041365967.1 | DNA polymerase IV | - |
| RG540_RS29890 | 1555735..1556043 | + | 309 | WP_041365969.1 | hypothetical protein | - |
| RG540_RS32710 | 1556915..1557300 | - | 386 | Protein_1496 | BA14K family protein | - |
| RG540_RS29900 | 1557248..1557451 | + | 204 | WP_040125337.1 | cold-shock protein | - |
| RG540_RS29905 | 1558278..1558571 | - | 294 | WP_041365974.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| RG540_RS29910 | 1558571..1558825 | - | 255 | WP_041365976.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| RG540_RS29915 | 1559144..1561111 | - | 1968 | WP_041365978.1 | Fe(3+)-hydroxamate ABC transporter permease FhuB | - |
| RG540_RS29920 | 1561108..1561992 | - | 885 | WP_041365980.1 | iron-siderophore ABC transporter substrate-binding protein | - |
| RG540_RS29925 | 1562006..1562818 | - | 813 | WP_041365982.1 | ATP-binding cassette domain-containing protein | - |
| RG540_RS29930 | 1562870..1563742 | - | 873 | WP_041366601.1 | alpha/beta hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | ddhA / htpB | 1..1807065 | 1807065 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11224.80 Da Isoelectric Point: 5.5922
>T285153 WP_041365974.1 NZ_HG938354:c1558571-1558278 [Neorhizobium galegae bv. orientalis str. HAMBI 540]
MRFSFSVEAEEDIIAIAEQSVRMFGSAQARRYYDELFAVLDLIAANPRMAREREEISPPVRIHPFKAHLVVYRIEENGAI
FVIRIRHGHEDWAGDPV
MRFSFSVEAEEDIIAIAEQSVRMFGSAQARRYYDELFAVLDLIAANPRMAREREEISPPVRIHPFKAHLVVYRIEENGAI
FVIRIRHGHEDWAGDPV
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A068T425 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A068T289 |