Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-VagC |
| Location | 1378386..1379059 | Replicon | plasmid pHAMBI540a |
| Accession | NZ_HG938354 | ||
| Organism | Neorhizobium galegae bv. orientalis str. HAMBI 540 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | RG540_RS29130 | Protein ID | WP_041365717.1 |
| Coordinates | 1378655..1379059 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A068T0M6 |
| Locus tag | RG540_RS29125 | Protein ID | WP_041365715.1 |
| Coordinates | 1378386..1378658 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RG540_RS29105 | 1373445..1375043 | - | 1599 | WP_046601468.1 | ABC transporter substrate-binding protein | - |
| RG540_RS29110 | 1375165..1375932 | - | 768 | WP_080725132.1 | GntR family transcriptional regulator | - |
| RG540_RS29115 | 1376023..1377270 | + | 1248 | WP_041365713.1 | glucarate dehydratase family protein | - |
| RG540_RS29120 | 1377333..1377826 | + | 494 | Protein_1342 | ribonuclease activity regulator RraA | - |
| RG540_RS32165 | 1377949..1378068 | - | 120 | Protein_1343 | helix-turn-helix transcriptional regulator | - |
| RG540_RS29125 | 1378386..1378658 | + | 273 | WP_041365715.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| RG540_RS29130 | 1378655..1379059 | + | 405 | WP_041365717.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| RG540_RS29135 | 1379302..1379667 | + | 366 | Protein_1346 | transposase | - |
| RG540_RS32695 | 1379670..1379792 | - | 123 | Protein_1347 | IS3 family transposase | - |
| RG540_RS29140 | 1379905..1381086 | - | 1182 | WP_041365719.1 | DNA-binding transcriptional regulator | - |
| RG540_RS29145 | 1381300..1382553 | + | 1254 | WP_046601469.1 | extracellular solute-binding protein | - |
| RG540_RS29150 | 1382619..1383551 | + | 933 | WP_041365724.1 | sugar ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | ddhA / htpB | 1..1807065 | 1807065 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14745.10 Da Isoelectric Point: 4.7581
>T285152 WP_041365717.1 NZ_HG938354:1378655-1379059 [Neorhizobium galegae bv. orientalis str. HAMBI 540]
MTGYLLDTNIISDIIRNPFGSAARRVEEIDPKEICTSIVVAAELRYGCAKKGSTKLLAKVESILETIPIMPLDMPADINY
GGIRAKLEAAGETIGLNDMLIAAHACALNLTLVTDNTREFQRIRGLDLENWLER
MTGYLLDTNIISDIIRNPFGSAARRVEEIDPKEICTSIVVAAELRYGCAKKGSTKLLAKVESILETIPIMPLDMPADINY
GGIRAKLEAAGETIGLNDMLIAAHACALNLTLVTDNTREFQRIRGLDLENWLER
Download Length: 405 bp
Antitoxin
Download Length: 91 a.a. Molecular weight: 10316.94 Da Isoelectric Point: 4.8952
>AT285152 WP_041365715.1 NZ_HG938354:1378386-1378658 [Neorhizobium galegae bv. orientalis str. HAMBI 540]
VPIPLPSSRPKEVKLFRNNRSQAVRIPAEFELPGDRVLIHREGNKLIIEPIARPANIIELLAEWKKEDLLGPEDQFPDIE
DMPAKPENIF
VPIPLPSSRPKEVKLFRNNRSQAVRIPAEFELPGDRVLIHREGNKLIIEPIARPANIIELLAEWKKEDLLGPEDQFPDIE
DMPAKPENIF
Download Length: 273 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|